You are on page 1of 215

Bukitap,lemCorafiBilgiSistemleriMhendislikveEitimLtd.ti. Tarafndanyaynlanmtr. 13.CadNo:14 06800BeysukentANKARA Tel:+903122335000 Faks:+903122355682 Email:info@islem.com.tr Web:www.islem.com.

.tr Yazarlar:GzdeTREYEN,pekZDEMR,TekinalpKURT Bu eserin her trl telif hakk 2010 lem Corafi Bilgi Sistemleri Mhendislik ve Eitim Ltd. tine aittir. Bu kitabn tamam ya da bir ksm yaync izni olmadan, internet, eposta, fotokopi, vb. elektonik ve mekanik yntemler kullanarak oaltlamaz, yaynlanamaz, datlamaz. Bu eser T.C. telif haklar kanunlar ve uluslararas geerlilii olan kanunlar tarafndan korunmaktadr. Yasalara uygunluun salanmas kullancsorumluluundadr. 2010lemCorafiBilgiSistemleriMhendislikveEitimLtd.ti. Herhakksakldr. Eserad:ArcGIS10DesktopUygulamaDokman lkbask:Ekim2010 ISBN:9789944586368

NSZ
Kalite Politikamz; Corafi Bilgi Sistemleri ve Uzaktan Alglama konusunda Trkiyede; Kamu Kurumlar, Askeri Kurumlar, zel Sektr ve niversite hizmet alanlarna kurumsallam bir anlay ile en ileri teknolojileri kullanarak, zamannda, gvenilir, ekonomik ve sorunsuz bir hizmet sunmak vebuhizmetleringeliiminivesrekliliinisalamaktr. Bu anlay ile hizmetlerimizi yerine getirirken, Corafi Bilgi Sistemleri ve Uzaktan Alglama teknolojileri ile projelerin gerekletirilebimesi iin, Corafi Bilgi Sistemi ve Uzaktan Alglama yazlmlarnn imkan ve kabiliyetleri, bir organizasyon ierisinde yneticiden kullancya kadar tm personeleeitilerekgsterilmesigereklidir. Sistemin baars bu teknolojileri kullanacak personel ve yneticilerin eitiminebaldr.Ennemlifaktrbukonudayetimiinsandr.

ERK
CORAFBLGSSTEMVETEMELKAVRAMLAR1 1.1CorafiBilgiSistemiNedir?..................................................................1 1.2CorafiBilgiSistemlerininYararlar......................................................2 1.3CorafiBilgiSistemlerininKullanmAlanlar........................................3 1.4CorafiBilgiSistemlerindeVeriYaps ..................................................5 1.5CorafiBilgiSistemlerininElemanlar..................................................8 1.6CorafiBilgiSistemlerininGenelFonksiyonlar ..................................10 VeriToplamaveretimTeknikleri......................................................11 VeriDepolamaFormatlar.................................................................... 12 AralarndakiFarkllklar........................................................................ 13 Sorgulama............................................................................................ 14 Analiz.................................................................................................... 15 kt...................................................................................................... 16 TemelHaritaBilgisi..18 Harita,lekveProjeksiyonlar................................................................18 Harita.................................................................................................... 18 HaritaninTarihesi............................................................................... 18 HaritalardaYnler,SapmaAlarveABirimleri...............................19 lek.................................................................................................... 22 HaritaProjeksiyonlar........................................................................... 22 HaritaReferansSistemleri................................................................... 30 ArcGIS10Mimarisi.......................................................................................36 ArcGISDesktop........................................................................................ 37 ArcGISDesktopiinisteebalmodller...............................................43 ArcGISServer........................................................................................... 51 ArcSDETeknolojisi.................................................................................... 53

ArcGISEngine...........................................................................................54 ArcGISveEndstriyelStandartlar............................................................56 ArcGIS10Uygulamalar...............................................................................57 Uygulama1:ArcMapeGiri................................................................... 57 ArcMapteSembolojiDeitirme.............................................................58 ToolsToolbarFonksiyonlarilealma;..................................................61 Uygulama2:ArcMapteRasterVerilerinGrntlenmesi;...................69 HaritayaBaseMapEklenmesi;..................................................................73 Uygulama3:VektrVeriTipleri(Shapefile,Coverages,FeatureClassve CAD);........................................................................................................ 75 KatmanzellikleriPenceresi;..................................................................76 Joins&Relates&Symbology;..................................................................84 Uygulama4:HaritalarnKartografikretimi,kt(Layout);...................99 Uygulama5:SembolojiKtphanesi(Style);........................................106 Uygulama6:CorafiVerilerinSorgulanmas;........................................116 SelectFeatures,SelectByAttribute,SelectByLocation,SelectBy Graphics;................................................................................................ 116 RaporOluturma:................................................................................... 130 GrafikOluturma:................................................................................... 134 Uygulama7:RasterHaritalarnCorafiOlarakKoordinatlandrlmas (Georeferencing);................................................................................... 136 Uygulama8:ArcCatalogdaVeritabanTasarm;.................................144 ArcCatalogdaESRIVektrVerilerininOluturulmas............................144 Uygulama9:VeriGiriiveGncelleme.................................................153 Uygulama10:VeriGncellemeveSaysallatrmaKabiliyetleri;..........161 Uygulama11:Diergncellemearalar;.............................................170 Uygulama12:VeriDnmFonksiyonlar;.........................................175 NoktasallmDeerlerininGrntlenmesi;.....................................184

AddXYDataFonksiyonu;....................................................................... 185 Uygulama13:ZamanBilgisiileanimasyonoluturma; .........................188 Uygulama14:ArcMapteMapPackageoluturulmas;.........................193 ArcGIS.comayelik;............................................................................. 195 Uygulama15:GrntAnalizi..............................................................202 Kaynaklar...................................................................................................208

CORAFBLGSSTEMVETEMELKAVRAMLAR

1.1CorafiBilgiSistemiNedir?
Corafi Bilgi Sistemleri (CBS), ok farkl disiplinler tarafndan kullanlmas nedeniyle deiikekillerde tanmlanabilmektedir. rnein; bir maden mhendisi iin Corafi Bilgi Sistemleri rezerv hesab iken, bir peyzaj mimar gznde peyzaj planlamas eklinde karmza kabilir ya da bir ziraat mhendisi iin rnlerin rekolte deerlerinin hesaplanmasnda bir ara iken, bir biyolog iin ise akla gelen ilk ey biyoeitlilik olabilir. Yine Corafi Bilgi Sistemleri baz meslek gruplarnda corafi bilgiyi ilenebilir biimde sisteme aktarmak, baz meslek gruplarnda ise bu ilenilebilir veriyi analizlerden geirmek suretiyle rnler elde etmek olarak adlandrlabilir. yleki;CorafiBilgiSistemlerinin(CBS),sonyllardakaydadeerbirekilde kullanmalannngenilemesi,biroksektrtarafndanyaplanalmalarda temel yazlm olarak kullanlmas, zellikle konumsal bazl yaplan almalarla ilgilenen kii, kurum ve kurulular arasnda olduka fazla ilgi duyulmas ve farkl meslek dallarnda genileyen bir yelpazeye sahip olmas standart bir tanm kalb ierisine sokulmasn deyim yerindeyse engellemitir. Ancak bu farkl ilgi ve bak alarna ramen Corafi Bilgi Sistemlerini tanmlamak gerekirse; karmak planlama ve ynetim sorunlarnn zlebilmesi iin tasarlanan; mekandaki konumu belirlenmi verilerin kapsanmas, ynetimi, ilenmesi, analiz edilmesi, modellenmesi ve grntlenebilmesini kapsayan donanm, yazlm ve yntemlersistemidir. Corafi Bilgi Sistemleri yukarda da grld gibi her meslek grubuna gre farkl ekillerde yorumlanmaktadr. Bu farkl yorumlamalara ramenCorafiBilgiSistemleribirbakmadnyazerindekiblgeleritarif eden, verileri saklayan ve kullanan bilgisayar sistemi olarak da tanmlanabilir. Yine Corafi Bilgi Sistemleri meknsal verilere (akarsu, parsel, bina, yol vb.) ait szel bilgileri bnyesinde entegre bir ekilde saklayanbirsistemdir. 1

1.2CorafiBilgiSistemlerininYararlar
Corafi Bilgi Sistemleri meknsal verilere ait szel bilgileri veritabannda entegre bir ekilde saklama yeteneinin yan sra, kendine has teknolojisiyle sorgulama ve istatistiksel analiz gibi klasik veri taban ilemlerini grselletirme ve haritalar tarafndan salanan corafi analizler ile birletirmektedir. Bu yetenei sayesinde Corafi Bilgi Sistemleri dier bilgi sistemlerinden ayrlmakta, kamu ve zel giriimlerde olaylarn aklanabilmesi, sonularn tahmini ve strateji gelitirebilmesi bakmnda nemkazanmaktadr. Dnyann eitli lkelerinde Corafi Bilgi Sistemlerinin kullanm beraberinde ham olan, sadece ofislerdeki klasrler ierisinde kat ortamnda bulunan verilerin bilgisayar ortamnda ilenmesine nayak olmutur. Corafi Bilgi Sistemlerinin gn getike artan potansiyeline bal olarak kullanmnn yaygnlamasnn yan sra saysal bilgilerin artmasyla da bilgileri kontrol etmek ve yorumlamakda doal olarak zorlamaktadr. te Corafi Bilgi Sistemleri (CBS) kii, kurum ve kurulularn mekansal tabanlverilerzerindeyapacaklaralmalardakararvermelerineyardmc olmaktadr. Yani CBS, hem veritaban ynetimi hem analiz hem modelleme yetenei hem de almalar esnasnda karar destek mekanizmas gibi birokvenemlizellikleribnyesindebarndrmaktadr.Bugibiyetenekler 2

ekil 1: Corafi Bilgi Sistemleri problemlerin zmnde etkin bir koordinatrdr.

de Corafi Bilgi Sistemlerini dier sistemlere gre her zaman n sralara tamaktadr. Corafi Bilgi Sistemlerinin yararlarn snrlandrmak neredeyse imkanszdr.AncakCBSninyararlarbakmndabirkarnekverilebilir; Bilgiaknhzlandrr. Dahaverimliretimveenvanterynetimisalar. verimliliiniarttrr. Etkili ve doru analizler (acil durum mdahale, kritik bilgi analizleri vb.)salar. Verigncellemekolaylsalar. gcnarttrrvezamankaybnnler.

1.3CorafiBilgiSistemlerininKullanmAlanlar
Corafi Bilgi Sistemleri, corafi verilerin sz konusu olduu her alanda uygulanabilir bir yap sunmaktadr. Corafyann ve dolaysyla corafi verinin kapsamnn ne kadar geni olduu dnlecek olursa, CBS uygulama alanlarnn da o denli uzun bir liste olarak karmza kaca sonucunavarlr. Teknolojik gelimelerle beraber farkl birok uygulamay iine alan Corafi Bilgi Sistemleri sorunlar karsnda i ve hizmetlerin tkanma noktasna geldii, mevcut yerleim yerlerinde ya da planlanan yerleimlerde, yerel yneticiler iin bir zm yolu olarak en ok nerilen yntemdir.Belediyeveyerelynetimlerde;evreynetimi,havzaynetimi, ulam planlama, uygun yer seimi, ok kriterli karar verme, kazdolgu almalar, akll harita retimi, alan planlamas, envanter almalar, senaryo ve trend analizleri, kirlilik modellemesi, boyutlu arazi modelleme, ara takibi, deprem hasar analizleri, vergi takibi vb. gibi birok kullanm alan bulunmaktadr. Corafi Bilgi Sistemlerinin kullanm alanlar sadece bunlarla snrl deildir.Bu alanlar belli balklar altnda toplamak gerekirse;

evre Ynetimi: evre dzeni planlar, evre koruma alanlar, ED raporu hazrlama, gller, gletler, sulak alanlarn tespiti, evresel izleme, hava ve grltkirlilii,kyynetimi,meteoroloji,hidroloji Doal Kaynak Ynetimi: Arazi yaps, su kaynaklar, akarsular, havza analizleri, yabani hayat, yer alt ve yer st doal kaynak ynetimi, madenler,petrolkaynaklar Mlkiyetdari Ynetim: TapuKadastro, vergilendirme, semen tespiti, nfus, kentler, beldeler, ky snrlar, idari snrlar, tapu bilgileri, mcavir alandndakalanalanlar,uygulamaimarplanlar Bayndrlk Hizmetleri: mar faaliyetleri, otoyollar, devlet yollar, demir yollar n ettleri, deprem zonlar, afet ynetimi, bina hasar tespitleri, binalarncinslerinegredalmlar,blgeselkalknmadalm Eitim: Aratrmainceleme, eitim kurumlarnn kapasiteleri ve blgesel dalmlar,okumayazmaoranlar,renciveeitmensaylar,planlama Salk Ynetimi: Salkcorafya ilikisi, salk birimlerinin dalm, personel ynetimi, hastane vb. birimlerin kapasiteleri, blgesel hastalk analizleri,salktaramafaaliyetleri,ambulanshizmetleri Belediye Faaliyetleri: Kentsel faaliyetler, imar, emlak vergisi toplama, imar dzenlemeleri, evre, park baheler, fen ileri, sukanalizasyon doal gaz tesis ileri, TV kablolama, uygulama imar planlar, nazm imar planlar, halihazr haritalar, altyap, ulatrma plan toplu tamaclk, belediye yollar vetesisleri Ulam Planlamas: Kara, hava, deniz ulam alar, doal gaz boru hatlar, iletiimistasyonlar,yerseimi,enerjinakilhatlar,ulamharitalar Turizm: Turizm blgeleri alanlar ve merkezleri, turizm amal uygulama imarplanlar,turizmtesisleri,kapasiteleri,arkeolojialmalar Orman ve Tarm: Eimbak hesaplar, orman amenajman haritalar, orman snrlar, peyzaj planlamas, milli parklar, orman kadastrosu, arazi rts, toprakharitalar Ticaret ve Sanayi: Sanayi alanlar, organize sanayi blgeleri, serbest blgeler, bankaclk, pazarlama, sigorta, risk ynetimi, abone, adres ynetimi Savunma ve Gvenlik: Askeri tesisler, tatbikat ve at alanlar, yasak blgeler, sivil savunma, emniyet, su analizleri, su haritalar, ara takibi, trafiksistemleri,acildurum 4

1.4CorafiBilgiSistemlerindeVeriYaps
Corafi Bilgi Sistemlerinde veri yapsn kavrayabilmek iin hereyden nce corafi bilginin aklanmas gerekmektedir. nk corafi bilgi dnya zerindeki herhangi bir varlk iin bilgiler vermektedir. Corafi Bilgi, birbirleriylebalantlayrbilgidenoluur: Corafi Konum (Koordinat) Bilgisi: Konumsal bilgi trdr. Corafi varln yer yuvarna ilikin belli bir datum (referans sistemi) ve projeksiyon dzenindekikonum(koordinat)bilgisidir. znitelikBilgisi:Corafivarlailikinznitelikdeeribilgisidir. Topolojik Bilgi: Matematik biliminin bir alt dal olan Topoloji bilimi esaslar evresinde; bir corafi varln, dier corafi varlklara gre komuluk ilikileri(sanda,solunda,banda,sonunda,vb.)hakkndakibilgilerdir. Corafi bilgi ierisinde yer alan bu zellikler Corafi Bilgi Sistemlerindekullanlanyadakullanlacakolancorafiverileriinnemarz eder. nk corafi verileri hem belli bir konum ile ilikilendirmek hem de corafi verilerin detay bilgilerinden farkl rnler elde etmek yaplan almalara ait nemli unsurlardandr. Bu itibarla corafi veri yapsn iki gruptaincelemekgerekir: Mekansal Bilgi: zelliklerin ya da corafi varlklarn yerini,eklini ve dier mekansal veriler ile ilikilerini belirler. Corafi konum ve topolojik bilgi bu grupierisindeyeralmaktadr. Tanmlayc Bilgi: zelliklere ya da corafi varlklara ait bilgilerin veri tabannda tutulmas ile oluan bilgilerdir. Bir baka deyile Corafi Bilgi Sistemlerinde kullanlan haritalara ait verilerin zellikleri ile ilgili detaylar ierenbilgilerdir. 5

Meknsal Veri Corafi bilgi ve corafi veri kavramlarna aklk getirdikten sonra ele alnmas ve CBS kullanclarnn bilmesi gereken bir dier nemli unsur da Corafi Bilgi Sistemlerindeki veri yaps mantdr. Corafi Bilgi Sistemlerindeveriyapsikiekildeelealnmaktadr: Vektr Veri: Belirli koordinat (x,y) deerleri ile depolanan verilerdir. Belirli bir koordinata sahip olan vektr veriler nokta, izgi, alan veriler olmak zere3eayrlr. Noktasal(Point)Veri:Tekbir(x,y)koordinatiftiiletemsiledilenverilerdir. Bu tr vektr veriler ekli ve snrlar ok kk olan birimlerin tanmlanmasnda kullanlrlar. rnein; tepe noktalar (zirve), elektrik direkleri,kuyular,aalar,vb. izgisel (Line) Veri: Birbirini izleyen bir dizi (x,y) koordinat serisi eklinde sistemde depolanan verilerdir. Bir dizi halinde birbirini izleyen ve alan olarak gsterilemeyen birimler iin kullanlrlar. rnein; yol, akarsu, elektrikhatt,vb. Alansal (Polygon) Veri: Balang ve biti noktalarnda ayn koordinata (x,y) sahip olan ve bir dizi koordinatlar ile sistemde depolanan verilerdir. rnein; parseller, binalar, gller, yerleim snrlar, orman alan, arazi kullanm,vb. 6 Tanmlayc (Meknsal Olmayan) Veri

ekil 2: Mekansal ve Tanmlayc Veriler

TepeNoktalar,Kuyular, Aalar,Direkler,vb.

Yol,Akarsu,ElektrikHatt,vb. Gller,Binalar,Parseller,vb. ekil3:VektrVeriTipleriveBirkarnek. Vektrel veriler corafi varlklarn kesin konumlarn tanmlamada son derece yararl verilerdir. Ancak, sreklilik zellii gsteren corafi varlklarn, rnein; toprak yaps, bitki rts, jeolojik yap ve yzey zelliklerindeki deiimlerin ifadesinde daha az kullanl bir model olarak bilinir. Vektrel verilerde grafik objeleri tanmlayan znitelik bilgilerine ulama,bubilgilerigncellemevedzeltmemmknvedahakolaydr. Raster Veri: Hcrelere (pixel) bal olarak temsil edilen verilerdir. Raster veri,birbirinekomugridyapdakihcrelerinbirarayagelmesiileoluurlar. ekilen fotoraflarn, taranan haritalarn ya da paftalarn sisteme aktarlmas ve vektr verilerden dnm (convert) ilemleri sonucu ile elde edilirler. Raster veriler vektr verilere oranla daha fazla veri depolama kapasitesine sahiptirler. Baz konumsal analizler (En uygun yer analizi, maliyet analizi,vb.) raster verilerde daha kolaydr. Ancak verilerin hassasiyeti raster verilerde hcre boyutuyla (pixel size) orantl olduu iin hassasalmalardaverikayplarnanedenolabilir.
Parsel Bina Bina

Yol

Gl

Arazi ekil4: CorafiVerilerinRasterVerizerindeGrn

Vektr ve raster veri modellerinden biri genelde CBS uygulama biimine gre tercih edilerek kullanlr. Ancak gnmzde her iki model ayn anda da kullanlabilmektedir. Vektr ve raster verilerin yukarda da aklandgibibirbirlerinegrestnvezayfynlerivardr. Raster Veri

Vektr Veri Arazi Yzeyi

ekil 5: Corafi Verilerin Vektr ve Raster VerilerzerindeGrn

1.5CorafiBilgiSistemlerininElemanlar
Bir sistemin, bir uygulamann ya da herhangi bir almann ayakta kalabilmesi ve ileyebilmesi iin baz gereksinimlere ihtiya vardr. Corafi Bilgi Sistemlerinin de ileyebilmesi ve salad avantajlardan en st dzeyde yararlanlabilmesi iin baz gereksinimlere, bileenlere ya da elemanlaraihtiyaduyulmaktadr: Veri (Data): Corafi Bilgi Sistemlerinde veri olmadan ilem yapmak imknszdr. nk veri bir bakma bu sistemin zdr ve Corafi Bilgi Sistemlerinindevazgeilmezbileenlerindendir. Yazlm (Software): Corafi Bilgi Sistemlerinin vazgeilmez bileenlerinden olan veri bu sistemin ileyebilmesi iin yeterli deildir.Verilerin ilenebilecei ve analiz edilebilecei bir yazlma ihtiya vardr.Bu ihtiyatan tr Corafi Bilgi Sistemlerinde vazgeilemeyen bir eleman ya da bileen deyazlmdr. Yntem(Method):CorafiBilgiSistemlerindeyaplacakvebirbirindenfarkl olan almalarda baarl ilemler gerekletirilmesi salkl yntemlerin 8

tespiti ile gerekleir. Belirlenecek olan bu yntem ya da yntemlerin de ok iyi tasarlanmas ve planlamas gerekir ki, gerek kiisel gerek kurumsal bazdaistenilenrnlerortayakarlabilsin. Donanm (Hardware): Corafi Bilgi Sistemleri bugn ok farkl donanma sahip bilgisayarlarda alabilmektedir. Ancak Corafi Bilgi Sistemlerinin ilgili yazlmndan maksimum performans elde etmek iin bilgisayar donanmnndayksekkalitedeolmasgerekmektedir. AadaArcGISDesktop10iingereklisistemgereksinimleriverilmitir. ArcView,ArceditorveArcInfoiin CPUHz 2.2GhzDualCoreyadadahafazlas lemci IntelCoreDuo,PentiumorXeonlemciler Memory/Ram 2GByadadahafazlas Grnt 24Bitrenkderinlii zellikleri Ekran 1024*78yadadahafazlasnormalboyutta(96dpi) znrl nbellek letimsistemitarafndanbelirlenir,minimum500Mb Kapladalan 2.4GB Video/Grafik Enaz128MB,tavsiyeedilen512MB Ekrankart Network TCP/IP nsanlar (People): Corafi Bilgi Sistemlerinde yukarda ad geen bileenler her ne kadar bu sistem ierisinde vazgeilemeyen elemanlar olsalar da insan olmadan bir btn oluturamazlar. nk CBS karardestek sistemi olmas itibariyle insan odakldr. nsanlar problemlerin zmnde karar verici ve sistem gelitirici olarak yaplan almalara ynelik plan hazrlarlar. Bunedenle,CorafiBilgiSistemlerininileyebilmesiiinbukonudayetimi yneticivepersonellereihtiyavardr. 9

Uygulamalar Veriler Donanm nsanlar Yazlm ekil6:CorafiBilgiSistemlerininBileenleri

CBS

1.6CorafiBilgiSistemlerininGenelFonksiyonlar
Corafi Bilgi Sistemlerinde ama corafi bilginin; retimini, ynetimini, analiz ve network zerindeki datk veri tabanlarndan corafi verileri tm insanlarn paylaabilecei profesyonel bir bilgi sistemi teknolojisi sunmaktr. Bu temel zerinden yolan kan ESRI, kullanclarn ihtiyacn karlayacak, kullanm kolay, modern, fonksiyonel ve profesyonel zmleri leklendirilebilir platformlarda sunabilen ArcGIS teknolojisini retmitir. Corafi Bilgi Sistemlerinde veri toplamadan veri retmeye, veri depolamadan grntlemeye kadar birok fonksiyon vardr. Ancak Corafi Bilgi Sistemleri fonksiyonlarn genel balklar altnda toplamak gerekirse; veri toplama teknikleri, veri depolama, veri grntleme, sorgulama, analizvekteklindebalklarkarmzakar.

10

ekil7:CorafiBilgiSistemlerininGenellevleri

VeriToplamaveretimTeknikleri
Corafi Bilgi Sistemlerinde (x,y) koordinatlarna bal verilerin sisteme aktarlmasnda farkl yntemler uygulamak mmkndr. Bu yntemler uygulanrken verilerin toplanmasnda ve vektr verilerin retiminde kullanlan baz altlk haritalar ve farkl kaynaklar mevcuttur. rnein; farkl leklerdeki haritalar (topografya, imar plan, fiziki, siyasi, vb.), uydu grntleri, hava fotoraflar ve yersel lm ile elde edilen koordinat bilgileri veri kaynaklar olarak tanmlanabilir. Hatta cep telefonu ya da fotoraf makinesi ile ekilen bir fotoraf dahi CBS teknolojisinde veri kaynatekileder. Corafi Bilgi Sistemlerinde ilgili veri kaynaklar temin edildikten sonra ArcGIS teknolojisinde gerek ekran zerinden otomatik olarak gerek elle (manual) veri retmek mmkndr. Ayrca ArcGIS teknolojisinde text dosyalarndan da veri retmek mmkndr. Yine text, excel, vb. dosyalarndan veri retmeninin yan sra, farkl yazlmlarda retilmi ve

11

bilgisayarortamndabulunanverileringereklidnmleriyaplarakdaveri retimigerekletirilebilir.

ekil8:CorafiBilgiSistemlerindeVeriretimindeKullanlanVeri Kaynaklar

VeriDepolamaFormatlar
Corafi Bilgi sisteminde yeryzne ait bilgiler, vektr ve raster formatlarda birbirlerinden soyutlanm farkl tabakalar eklinde depolanrlar. Corafi Bilgi Sisteminde bu iki format, corafi analizlerde ve sorgulamalarda etkin bir biimde kullanlr. Bu sorgulama ve analizlerde, vektrverasterverilerinyukardadaaklandgibibirbirlerinegrestn vezayfynlerivardr. VektrelVeri,formatndakonumaaitveriler;nokta,izgivealanzellikleri x,y koordinat deerleriyle depolanrlar. Nokta zellii tekbir x,y koordinat iftiiletemsiledilenverilerdir(ElektrikDirekleri,YangnMusluklari,Kuyular gibi). izgi zellii, bir balang ve bir biti noktas olan x,y koordinatlar dizisi ile temsil edilirler (Dereler, Yollar, Elektrik Hatlar gibi). Alan zellii 12

ise, balang ve biti noktas ayn olan x,y koordinatlar dizisi ile temsil edilirler.(Parseller,Binalar,AraziKullanmgibi) RasterVeri,formatndakonumaaitverilerise;hcrelerebalolaraktemsil edilir. Ayn boyuttaki hcrelerin bir araya gelmesi ile oluurlar. En kk birim pixel olarak tanmlanr. Raster verilerde verinin hassasiyeti pixel boyutunagredeienznrlk(resolution)zelliiiletanmlanr.Raster veride her pixel bir deere sahiptir. Bu deer bazen corafi bir zellie ait kod deeri olarak tanmlanabilir ve ESRI Grid formatnda bu kod deeri Value Attribute Table (Vat) yapsnda depolanr.Ya da o pixel 0255 renk aralndabirdeeritar. AralarndakiFarkllklar Rasterverilerinveridepolamahacmivektrverileregreoldukabyktr. Baz konumsal analizler (Bindirme analizleri, Alan hesaplamalar ve yaknlk analizleri gibi) raster veri formatnda daha kolaydr.Verilerin hassasiyeti raster verilerde pixel size ile orantl olduu iin hassas almalarda veri kayplarna neden olabilir. Vektrel veri formatnda grafik objeleri tanmlayan znitelik bilgilerine ulama ve gncelleme daha kolaydr. ekil9

Gldetaynnvektrel olaraktemsili.Gliled evrekyizgisiile ayrlmaktadr

Aynglnrasterolarak temsiledilmi hali.Rasterlarda hcreler,corafibilgiyi vermekzerekodlanmtr

13

Sorgulama Corafi Bilgi Sistemi grafik ve grafik olmayan verilerin birbirleri ile btnleik olarak sorgulanmasna olanak tanr. Buna gre grafik veriden szel verilere, szel verilerden de grafik (konumsal veriye) verilere hzl bir eriimsalanmolur. SelectFeature&SelectByAttribute&SelectByLocation Corafi Bilgi Sisteminde depolanm bir yol objesinin tanmlanmas ile, o yolun uzunluk,ad,tipi,vbbilgilerehzlbireriimsalanmolur. Birparsel tanmlandnda o parselin alan, evre, ada ve parsel numaras gibi bilgilerine eriim salanm olur. Veri tabanndan mantksal ifadeler kullanlarak grafik verilere ulalm olur. ehir ad tanmlanarak ilgili katmandaki istenilen ehirler ekranda grntlenebilir.Sorgulama yaplrken program ierisinde SQL (Structured Query Language) ifadeleri kullanlmaktadr.

SelectbyLocation Farkl katmanlardaki verilerin (Yol,Mahalle Snrlar, Parseller, Okullar,le Snrlargibi)birbirleriileilikilendirilmesidir.rneinbirmahalleiinegiren parsellerin, okullarn seilmesi, demiryolunun getii illlerin seilmesi, bir sanayi alanna belli bir mesafede olan yerleim yerlerinin belirlenmesi gibi mekansalsorgulamalaryaplabilmektedir.

14

Analiz CorafiBilgiSistemindedepolananverilerzerindekonumadayalkararlar verebilmecorafiverininsorgulanmas,grntlenmesiveanalizlerile mmknolmaktadr.Konumsalanalizilemlerinde,mevcutgirdilerden yararlanlarak,yenibilgikmeleriretilir. TamponBlgeleme(Buffer), BindirmeAnalizleri(Overlay), YaknlkAnalizleri(Proximity), GrnrlkAnalizleri(ViewshedAnalysis), TaknAnalizleri, YerseinAnalizleri, Younlukanalizleri(DensityAnalysis) KsayolveAltyapYnetimAnalizleri(NetworkAnalysis), YzeyAnalizleri(3D,Aspect,Slope,Elevation,Visibility,LineofSite, Cut&Fill),

15

ekil 10. Corafi Bilgi Sistemlerinde yaplabilecek baz analizlere rnek grntler kt Sistemde depolanan vektr veriler, veri taban bilgilerine gre snflandrlarak farkl zelliklerde grntlenebilirler. Sistemde yer alan semboloji ktphanesi ile, vektr verilere izgi tipleri, tarama, renk ve grafik semboller atayarak ilgili ynetmeliklere gre harita grntleme ilemleri hzl bir ekilde gerekletirilir. ArcGIS sisteminde vektr verilerin grntlenmesinde, Single Symbol, Unique Values, Graduated Colors, Graduated Symbols, Dot Density, Pie Chart, Bar/Cloumn, Stacked gibi zellikler kullanlr. Bu fonksiyonlar ile ynetmeliklere dayal tematik haritalama, standart topografik kadastral ve zel amal harita retimleri ArcGISteknolojisiileesnekvehzlbiryapyakavumutur. 16

ekil 11.Veri Grntleme ve kt ilemlerinde kullanlan semboloji ktphaneleri ArcGISdeVektrveRasterverigrntlemezelliklerininyansraveri tabanbilgilerininetiketlenmesi,raporlanmasvegrafiklerilegsterimleri demmkndr

17

TemelHaritaBilgisi
Harita,lekveProjeksiyonlar
HaritalarDnyannGrafiksunumlardr. Harita Dnya yzeyine ait herhangi bir ksmn veya bir parann, kubak grntsnnmatematik yntemlerle belli bir lee gre kltlerek zel iaretleriyle bir dzlem zerineizilmibirrneidir. HaritaninTarihesi lkharita,insanlarnkendiarazilerinibelirlemeihtiyacndanortayakmtr. Balangta haritalarn yerine basit krokiler kullanlmtr. Bilinen ilk kroki M 4000 yllarnda tula zerine yaplan Babilehrinin planlardr. Nirengi esasnadayalharitaise1615ylndaSinelliustarafndanyaplmtr.Uydu kefi ve bilgisayar teknolojisindeki gelimeler, son 30 yl ierisinde harita ve grnt istihbaratnda devrim niteliinde degiiklikler meydana getirmitir. Saysal veri teknolojisi diye isimlendirilen bu devrim ile, klasik haritaclk dnemi geride kalm ve yerine saysal haritaclk dnemi balamtr. lkemizde haritaclk Piri Reis dnemine kadar dayanmaktadr. Trkiyeyi ierecek tarzda yaplan ilk harita serisi; 1:200.000 leinde, Bonne projeksiyon sistemine gre yaplmtr. 123 paftadan olusan bu seri harita, Ayasofya Camisinin kubbesini balang meridyeni olarak kabul ederek, 19111929 yllar arasnda retilmitir. lk 1:25.000 lekli haritalar, 1909 1932 yllarnda Bonne projeksiyon sistemine gre oluturulmutur. Takiben 19461956yllararasnda,Meedamebde(orijin)noktasalnarak,Gauss 18

Kruger projeksiyon sistemi ile, 6 derecelik paftalar meydana getirilmitir. 1956ylndaise,ED50datumunageilmitir. HaritalardaYnler,SapmaAlarveABirimleri Haritalarda; Kuzey, Gney, Dou ve Bat olarak isimlendirilen 4 ana yn bulunmaktadr. Harita zerindeki herhangi bir yer, balang ynne ve istikametasnagretanmlanmaktadr. a.Ynler: Kuzey ana ynne dayal olarak herhangi bir yerin tanmlanmas; Gerek Kuzey, Manyetik Kuzey ve Grid Kuzeyi olarak adlandrlan ana yne greyaplmaktadr. Gerek Kuzey: Corafi kuzey veya harita kuzeyi olarak da ifade edilen gerek kuzey, yeryzndeki herhangi bir noktadan kuzey kutbuna ynelen dorultudur. Tm meridyen (boylam) dairelerinin yn gerek kuzey dorultusundaolup,budageneldebiryldzaoryanteedilmitir. Manyetik Kuzey: Yeryzndeki herhangi bir noktadan manyetik kutba ynelenveyapusulaibresiningsterdiidorultudur. GridKuzeyi:Haritazerindedikeygridizgileriningsterdiiistikamettir.

ekil12.Gerekkuzey,ManyetikkuzeyveGridkuzeyi Dnyann ekli bir kreye benzediinden, meridyen daireleri kutuplarda birleecek tarzdadr, yani birbirlerine paralel deildir. Bu nedenle, deiik meridyen daireleri zerinde bulunan noktalar birletiren dorularn her iki ucundaki gerek kuzey istikametleri de birbirine paralel deildir. Harita zerindekigridizgileriisebirbirineparaleldir.

19

Dnyann manyetik kuzeyi ilegerekkuzeyaynmevkidedeildir. Manyetik kuzey, dnyann dn ekseninden takriben 11 derece farkldr. Dier bir deyilemanyetikkutup7100Kuzey9600Batdadr. b.SapmaAlar: GridManyetik Sapma As ve Manyetik Sapma As olarak tanmlanm2tipSapmaAs bulunmaktadr. GridManyetik Sapma As: Manyetik kuzey ile grid kuzeyi arasndaki adr. ManyetikSapmaAs:Gerekkuzeyilemanyetikkuzeyarasndakiadr.

ekil13.GridmanyetiksapmaAs(a)vemanyetiksapmaAs(b) Manyetiksapmaas,gerekkuzeyindousunaveyabatsnagrebelirtilir. Haritalarzerindeise kesik hatlar halinde rnein 30E veya 150W tarznda gsterilirler. Bu alar, bazlkelerdehemdou hem de baty iermektedir. Trkiyede ise daima dousaldr. Harita zerinde llen istikametler hakiki basin, uak ile uulan istikametler ise manyetikbasinolarakifadeedilir.Eerhakikibasin olarak llen dou sapma deerini ieriyorsa, bu deer hakiki basin deerindenkarlr.Hakikibasin lld yer bat sapma deerini ieriyorsa, bu deer hakiki basin deerineeklenir.

20

ekil14.KuzeyAmerikayailikinmanyetiksapmaalar c.HaritaABirimleri: lkemizde retilen haritalarda Derece, Grad ve Milyem a deerleri kullanlmaktadr. (1)Derece: En ok kullanlan a birimidir. Bir daire evresinin 360 eit paraya blnmesiylemeydana gelen yay, dairenin merkezinden gren aya, bir derece denir. 1 derece=60dakika,1dakika=60 saniye,keza1derece=3600saniyedir. (2)Grad: Bir daire evresinin 400 eit paraya blnmesiyle meydana gelen yay, daireninmerkezinden grenaya,birgraddenir.Birdika(900)100graddr.1grad/100=grad dakikas,1graddakikas/ 100=gradsaniyesidir. (3)Milyem: Bir daire evresinin 64 eit paraya blnmesiyle meydana gelen yay, daireninmerkezinden gren aya bir TAM, bu tamn yzde birine ise bir milyem denir. Bir daire 6400 milyemdir. 21

lek lek, harita zerinde belli iki ayrnt arasnda llen uzunluun, bu iki noktannaraziuzunluuna orandr. Genel olarak bir kesirle ifade edilir. rnein 1/25000 lekli bir haritadendiinde1rakam birim deeri ifade eder ve haritadaki iki nokta arasndaki uzunluktur. Arazidebuikinoktannuzunluu bu birim deerin 25000 kat demektir.Dier bir ifade ile; lek = Harita Uzunluu/AraziUzunluu demektir.

HaritaProjeksiyonlar Kresel sekildeki dnyanin, bozulmakszn dz bir sath zerinde gsterilmesiolanakszdr.dealbir harita; doru EKLLER, SAHALARI, MESAFELER ve STKAMETLER ieren zellikleresahip olmaldr. Bu zelliklerin bazlarn kapsayan haritalar muhtelif projeksiyon uygulamalarileretilmitir. Genelolarak3tipharitaprojeksiyonubulunmaktadr.

22

Silindirik

Konik

Dzlemsel

ProjeksiyonTipleri: Silindirik,Dzlemsel,Konik SilindirikProjeksiyonlar (1)MerkatorProjeksiyonu: Merkezinde bir k kayna bulunan kresel dnyann, ekvatoruna teet olarakgeirilen bir silindir vastasyla harita elde edilmesini salayan bir projeksiyondur. Merkator projeksiyonuna sahip olan haritalarda sadece ekvatora yakn olan blgelerdedoru sonular alnr. Kutuplara doru gittikeekiller bozulur. rnein 7.700.000 milkarelikbirsahayasahipGneyAmerikaile800.000milkarelikGronland adas ayn byklkte grnr. Kk bir sahada (1 derecelik kare) herhangibirekilbozulmasmeydanagelmez. 23

Merkator projeksiyonu ile yaplan haritalar aada belirtilen zelliklere sahiptir: Meridyenler,birbirineparalel,eitaralklvedzizgilereklindedir. Paraleller, birbirine parelel olmasna ramen kutuplara doru gittike aralar alr. 60 derece paralelindeki, paralel dairelerinin birbirinden olan uzaklklar ekvatordakilerin iki mislidir. Ekvatorda 1: 1.000.000 lekli olan harita, 60 nc paraleldairesinde1:500.000leklidir.80inciparaleldairesindeise lek, 6 katna kar. Bu nedenden, 80 inci paralel dairesinden kutuplara kadar olanksmnharitalaryaplmaz. Meridyenlerveparalellerbirbirinediktir. Meridyenleri ayn a ile kesen hatlara Kerte hatt denir. Meridyenler birbirine paralelolduuiinkertehattdorudur. Bykdaireekvatorharieridir. Mesafelervesahalardolaysylaekiller,kutuplarcivarndaarderecede bozuktur. (2)TransversalMerkatorProjeksiyonu: Herhangibirmeridyendairesineteetolarakgeirilensilindirileeldeedilen projeksiyondur. Buna GaussKruger projeksiyonu da denir. lkemizde de kullanlanve zellikle topografik haritalarin retiminde tercih edilen bir projeksiyondur. Teet meridyeninden uzaklatka hata oran artmaktadr. rnein bir meridyenden1.5derece (130 Km.) uzaklkta bulunan yer sath zerindeki 1000 metrelik bir uzunluunsilindir zerindeki iz dm biraz byyerek 1000.22 metre olur. 3 derece uzaklktaisebudeer, 24

1000.83 metreye kar. Dier bir deyile 83 santimlik bir hata meydana gelir.Dahafazla hatay nlemek iin haritalar, arazi paralar 3 ve 6 derecelik dilimler halindeizdmleri karlarak yaplr. 1:25.000 ve daha kk lekli haritalarda dilim genilikleri6 derecedir. Byk lekli (mikyasl) haritalarda ise 3 derecedir. Bu projeksiyontipiUTMGRID referanssistemininesasdr. Transversal merkator projeksiyonu ile yaplan haritalar asada belirtilen zellikleresahiptir: Silindirinteetolduumeridyen,silindirvednyadaortakolduundan, uzunluktabirdeimemeydanagelmezyanilekheryerdeayndr. Merkez meridyenin yani silindire teet olan meridyenin sanda ve solundaki sahakapsamndaki(3veya6derecelikdilim)ekillernormaldir. Alardoruolup,kertehattkavislidir. Ynlerdorudur.

25

KonikProjeksiyonlar: (1)PolikonikProjeksiyon: Ekseni, koninin tepe noktasna gelecek ekilde dnya kresi zerine geirilenmuhtelif konilervastasylayaplanprojeksiyondur. Polikonik projeksiyonu ile yaplan haritalar, aada belirtilen zelliklere sahiptir: Ekvatorvemerkezimeridyenbirbirinedikvedzhatlarhalindedir. Merkezimeridyeninherikitarafndakimeridyenler,iebkeykavisliolup, ekvatordankutuplaradorubirbirlerinebirleecekekildedir. Merkezi meridyen zerinde, paralellerin aralklar birbirine eit fakat kavislidir. Merkezi meridyeninherikitarafnda 560millikbir sahaiinde, lekteve saha zerindekihatalar%1iamaz. Ynlerdorudur. Kertehatteridir. (2)LambertKonformalKonikProjeksiyon: Dnya kresinin iki standart paraleli arasnda bir koni vastas ile yaplan projeksiyonudur. lek hata limitini en asgariye indirmek ve hakiki doruluu salamak iin, standart paraleller aras 20 dereceyi gememelidir. Standart paraleller zerinde lektamamen 26

doru olup aralarndaki lek ise, muayyen bir derecede klr. Standart paraleller dndalekgittikebyr. LambertKomformalKonikprojeksiyonunbalcazellikleriunlardr: Meridyenlerkutuplardakesiendzdorulardr. Paralellermerkeziaynolanyayparalardr. Standartparalellerboyuncaleksabittir.Buparalellerarasndabtn istikametlertakribendorudur. Byk daireler olduka dz hatlar halindedir. (uzun mesafelerde kavislidirler) Kertehatthafifeeridir.

27

KonikProjeksiyon DzProjeksiyonlar Dz projeksiyonlardan en popleri Gnomonik projeksiyonlardr. Yeryz zerindeseilmiolan herhangi bir noktaya teet olarak dz bir sath konularak elde edilirler. Bu projeksiyonileelde edilenharitadateetnoktasndanuzaklatkca,bykbozulmalar meydana gelir. Projeksiyonun en nemli zellii byk dairenin dz bir hat eklinde olmasdr.Buzellik, dnya zerindeki 2 nokta arasnda, en ksa mesafeyi verir. Bu nedenle kutuplarayaknolan uularda,butipprojeksiyonlayaplmharitalarkullanlr. Sathn dnya zerine teet olarak konduu noktaya gre Gnomonik projeksiyonlar;Kutbi Gnomonik (sath kutuplara teet), Ekvator Gnomonik (sath ekvatora teet)veEik Gnomonik (sath dnya kresine eik durumda ve herhangi bir noktaya teet)olarak adlandrlrlar. Gnomonikprojeksiyonlarinbalcazellikleriunlardr: Meridyenlerdzbirhathalindekidorulardr. Paraleller eit aralkta olmayp; kutbi gnomonikte daire, ekvator ve eik gnomonikteise kavisliekildedir. 28

Bykdairelerdzhathalindedir.Kertehatteridir. Teetnoktasndanuzaklatkaekilvesahalarfazlacabozulur.

29

HaritaReferansSistemleri Harita zerindeki noktalarn ve sahalarn yerlerinin belirtilmesi iin kullanlanmetodlarareferans sistemleri denir. Bir referans sistemi, genel olarak bir seri harf ve rakam ierir.3tipharitareferans sistemibulunmaktadr. CorafiKoordinatSistemi: Corafi Koordinat Sistemnde bir mevkinin belirtilmesi iin meridyen ve paraleller kullanlr. Meridyen, bir paralel boyunca ana meridyenin (Greenwich sfr meridyeni) dousuna veya batsna, paralel ise bir meridyen boyunca ekvatordan itibarenkuzey veya gneye doru llr. Meridyen ve paralellerin deeri kutbi ve ekvatoragre meydanagelenadeeridir.

ekil15.CorafiKoordinatSistemi 30

ekil16.DnyazerindekiMeridyenveParaleller Haritada bir noktann tarifi; ekvatorun kuzeyindeki paralel (K veya G, N veya S) ve ana meridyenin dousundaki veya batsndaki meridyen (D veya B, E veya W) belirtilerek yaplr. Bu paralel ve meridyenler harita zerinde genel olarak 1er derecelik kareler halindedir. Her bir derece hatt zerinde 1erdakikalariaretlenmitir.(1derece60dakika,1dakika60saniye)Her5 dakikadabiruzunizgikonulmutur. Bir yerin bildirilmesinde, paralel ve meridyenin kesime noktas alnarak nceparalel deerisonrameridyendeeriyazlr.ParaleldeerindensonraKveyaG harfleri, meridyendeerinitakibeniseDveyaBharflerikonur.Karklaneden olmamakiin harfler arasna nokta ve virgl gibi iaretler konmaz. Paraleller 2 haneli, meridyenlerise3 haneli rakamla gsterilir. Dakika ve saniye deerleri 2 haneli rakamla belirtilir. GeorefSistemi: Rapor etme ve tesbit iin, paralel ve meridyenleri uygun bir form iinde gsterenbir sistemdir. Dnya corafi gridi diye de anlan bu sistem, projeksiyon tipi dnlmeksizin paralelvemeridyenleriierenherhangibirharitayauygulanabilir.Busistem hava 31

savunmas ve geni alanlardaki hava harekatlar iin kullanlmak zere meydana getirilmitir. Keza Kara ve Deniz Kuvvetleri iin de yardmc ilave bilgileri kapsamaktadr. Bu sistemde dnya yzeyi sistematik olarak baz blgeler hari 15 derecelik drtgenlere blnmtr. 15 derecelik bu dilimler; 180 derece meridyeninden balayarak douya doru A Z harfleri ile (I, I, O, , harfleri hari), 80 derece gney paralelinden balayarak 80 derece kuzey paraleline doru A M harfleri ile (I ve harflerihari) tanmlanmtr. Arazinin buzul ile kapl olmas nedeniyle, bu blgelerde arazi5 derecelik dilime (80 derece gney 75 derece gney, 80 derece kuzey 75 derece kuzey) ayrlmtr. Bylece dnya douya doru 24, kuzeye doru 12 dilim olmakzere 288drtgeneblnmtr.Budrtgenlerdenherbirincedouya,takiben kuzeyedoru okunan2harfiletemsiledilmitir. ekil 15de taranm olan drtgen, douya doru (saa) M diliminde, kuzeyedoru (yukar) G dilimindedir. Bylece dikdrtgen blge, MG harfleri ile belirtilir. Her 15 derecelik drtgen, ayrca 1er derecelik 15 drtgene blnmtr. Budrtgenlerde, douya ve kuzeye doru A Q harfleri (I, I, O, harfleri hari) ile belirtilmitir. Bylece 1x1derecelik drtgenlerde, 2 harf grubu ile tanmlanmtr. 1x1 derecelik drtgenin tanm, 15 dereceyi temsil eden harf grubunun da ilavesi ile 4 harfgrubu tarafndanyaplmaktadr. 32

Dnya zerindeki 1 dakikalik herhangi bir mevkinin tesbiti 4 harf ve 4 rakamilemmkn olmaktadr. Harflerden sonra gelen ilk iki rakam mevkiin bir derecelik drtgeniinde douya doru kanc meridyen dakikasnda, son iki rakam ise bir derecelik drtgenin gney paralelinden itibaren kuzeye doru kanc paralel dakikasnda olduunaiaret eder. Eer daha fazla bir doruluk istenirse, her 1 dakikalik drtgen douya ve kuzeyedoru ondalkltaliksmlaraayrlr.Bylece4harfve6rakamgurubuortayakar ki,bubir mevkiin1/10dakikasnbelirtir.okdahahassasmevkiitayinindedakikann 1/100ne kadarinilebilir.Buhassasiyet4harfve8rakamileifadeedilir. GridKoordinatSistemi 1947 ylndan nce dnyada, standart bir grid sistemi yoktu. Yaplan almalar sonucunda 80 derece kuzey ve 80 derece gney paralelleri arasnda kalan blgeiin UNVERSAL TRANSVERSAL MERKATOR (UTM) grid sistemi meydana getirilmitir.Grid sistemi, harita zerine izilmi dikdrtgenlerden oluan bir koordinat sistemidir. Dikdrtgenler birbirine dik ve eit mesafeli 2er paralel hattan olumutur. Hatlar arasndakimesafeumumiyetleharitalegindekimetreveyayardagibikati birsayy gsterir. Bir grid, arazi zerinde bulunan iki nokta arasndaki mesafe ve azimuthusratle tespit etmeye olanak salar. Baz haritalar birden fazla gridi kapsarlar bu durumdaher grid,farklbirrenkilegsterilir. 33

Bu sistemde dnya; 6x8 derecelik dilimlere, takiben 100.000 ve 10.000 metrelikkarelere blnmtr. Burada dikkat edilecek husus, nce saa takiben yukar deerlerin okunmasdr. 6x8DerecelikDilimler Dnya kresinin 80 derece gney ve 80 derece kuzey paralelleri arasnda kalan saha; doubat istikametinde 6 derecelik, gneykuzey istikametinde ise 8 derecelik dilimlere (zone) blnmtr. 6 derecelik dilimlerin balang meridyeni 180derece olup160rakamlarile,8derecelikdilimlerinbalangc80derece gneyparaleliolupCX(I,I,O,harflerihari)harfleriile tanmlanmtr. Bylece 6 x 8 derecelik bir dilim, 1 veya 2 rakam ve 1 harf ile belirtilmitir (ekil16). rnein; 5N tanmnda, 5 rakam 6 derecelik dilimi,N harfi ise 8 derecelik dilimi, 34S tanmnda ise, 34 rakam 6 derecelik dilimi,S harfiise8derecelikdilimibelirtmektedir. 100.000MetrelikKareler: Her 6 x 8 derecelik dilim, saa ve yukar doru 100.000 metrelere blnmtr. Meydanagelenherbirkareikiharfileifadeedilir. Alfabetiksradahilinde balang meridyenindenitibarendouya doruher 100.000 metre, A ve Z (I, I, O, harfleri hari) harfleri ile belirtilir. Bu 18 derecelik birsahaykapsar.Alfabetiksraher18derecedeyenidenbalar. Ayrca gneyden kuzeye doru her 100.000 metre A ve V (I, I, O, harfleri 34

hari)harfleriilebelirtilir.Alfabetiksraher18derecedeyenidenbalar.Bu harflendirmede tek numaral dilimlerin balangc ekvator olup A V harfleriile tanmlanmlardr. ift numaral dilimlerde ise, balang noktas ekvatorun 500.000 metregneyindekabuledildiindenekvatoraFharfiisabetetmektedir. Ksaca tek numaral dilimlerde harflendirme A dan, ift numaral dilimlerdeise ekvatordankuzeyedoruolmakzereFdenbalar. 10.000MetrelikKareler: Kenarlar 100.000 metre olan karelerde, 10 eit ksma blnerek sfrdan dokuza(0 9) kadar numaralandrlmtr. Bylece meydana gelen 10.000 metrelik kareler, harita zerinde umumiyetle mavi izgilerle gsterilmitir. Bu kareler iindeki herhangi bir noktann mevkii, 10 ksma blnm olan ve her biri 1000 metreyi gsteren effaf ablon (template) kullanm ile belirlenir. 1000 metrelik templatekareleri iinedenbirnoktanntesbiti,haritannleinebalolarakgzkararile 100, 10,1metreyekadaryaplabilir. 35

ArcGIS10Mimarisi
ArcGIS, Corafi Bilgi Sistemi konusunda, masast, server, web kullanclar ve arazi alanlar iin leklendirilebilir bir yap sunmaktadr. ArcGIS rnleritemelde5snfaayrlmaktadr; ArcGIS Desktop : leri dzey Corafi Bilgi Sistemi almalar iin 3 rn sunmaktadr;ArcView,ArcEditor,ArcInfo ArcGIS Server : Corafi Bilgi Sistemi ile oluturulmu haritalar web servisleri olarak sunmay ve web uygulamalar yaratmay salar. Ayrca kurumsalveritabanynetiminisalar. ArcGISMobile:Arazialmalariinzelaraveuygulamalarasahiptir. ArcGIS Engine : C++, .NET, veya Java kullanan uygulama gelitiricilere yazlmbileenleriktphanesisalar. ArcGIS Online : Kendi web uygulamalarnzda kullanabileceiniz, ESRI ve ortaklar tarafnda yaynlanm haritalarn bulunduu, web zerinden ulalabilenbirktphanedir.

ekil1:ArcGISMimarisi

36

ArcGISDesktop
Corafi Bilgi Sistemi kullanclarnn, corafi veriyi kullandklar, ynettikleri veyaynladklarbirincilplatformdur.Buplatformdakullanclar,haritalama, veriyaynlama,analiz,veritabanynetimivecorafibilgininpaylamgibi snrszilemibiraradagerekletirebilmektedirler. ArcGIS Desktop farkl kullanclarn gereksinimlerini karlamak zere leklendirilebilirbiryapyasahiptir. ArcView, ok kapsaml veri kullanm, haritalama ve analizler zerineodaklanmaktadr.

ArcEditor ArcView

ArcEditor, ArcView yazlm zelliklerine ek olarak gelimi veri retimi ve veri gncelleme yeteneklerinesahiptir. ArcInfo, ok kapsaml CBS fonksiyonlar ve ok zengin ilemler ieren corafi profesyonelbiryazlmdr.

ArcView, ArcEditor ve ArcInfo rnleri ayn mimariyi paylamaktadrlar. Dolaysylabunlardanherhangibirtanesiilealankullanc uygulamalarn dier kullanclar ile paylaabilmektedir. Haritalar, veri semboloji, harita katmanlar, zel aralar ve arayzler, raporlar ve dierleri bu rn ierisindeetkileimliolarakkullanlabilmektedir.

37

Hangi ArcGIS Desktop rnnn sizin iin uygun olduunu aadaki matrisebakarakbelirleyebilirsiniz.

ekil2:ArcGISFonksiyonMatrisi

38

Ekolarak,cretsizArcReaderrn,zelArcGISEngineuygulamalarve ArcGISServerkullanlarakoluturulanileridzeydeCBSwebservislerive uygulamalarArcGISmimarisinindierglelemanlardr. ArcGIS Desktop yazlmlar ArcMap, ArcCatalog, ArcGlobe, ArcScene, ArcToolboxveModelBuildergibiuygulamavearayzleresahiptir.
ekil3:ArcMapArayz ekil4:ArcCatalogArayz

ArcMap
ArcMap, mevcut grafik ve szel verilerin grntlenmesi, gncellenmesi, sorgulanmas, analiz edilmesi, grafiklerinin oluturulmas ve raporlanmas ilevleriilekullancya,yksekkalitedekartografiksunumlarsalamaktadr.

ekil5: ArcMapteoluturulmu Boruhatlarharitas

ekil7: Representation Sembolleri ekil6: Semboloji Ktphanesi

39

ekil8: ArcMapte oluturulmurapor

ArcCatalog

ekil9: ArcMapte oluturulmugrafik

ArcCatalog kullancya, grafik ve szel verileri tanmlama, gzden geirme, ynetme ve organize etme ilevlerini sunmaktadr. ArcGIS 10dan itibaren ArcMap arayz ierisinde bir pencere olarak da alabilen ArcCatalog aadakifonksiyonlarasahiptir. likiselveritabanlarnadirekbalant WindowsExplorerabenzerilevler Veritipleri,ierikleriveikongrntleme Dragdropzellii Projeksiyonsistmeleriningrntlenmesiveynetilmesi Veri tabannda yer alacak olan alanlarn (field) belirlenmesi ve tm zelliklerininyentilemsi ESRI ArcGIS veri formatlarnn oluturulmas (Shapefile, Coverage, FeatureClass) Verieriklerininoluturulmas(ItemDescription)

40

Verilerinnizlemesininyaplmas(Preview) UML (Unified Modeling Language) ile oluturulmu nesne modellerindengeodatabaseyaratma Grafik ve Szel verilerin arasndaki ilevlerin tanmlanmas (Subtypes, Domains,RelationshipClass) VeriYnetimi(Copy,Rename,Delete) YerelalarvewebzerindeCBSverilerininsorgulanmas ArcToolbox(Geoprocessing)

ekil10:ArcCatalogArayz

ArcToolboxveModelBuilder

ekil11:ArcCatalog Arayznnnizlemezellii

Geoprocessing, Corafi Bilgi Sistemi ierisindeki oklu ilemlerin ve metodlarnotomatikhalegetirilmesiiinkullanlmaktadr.Kullanclar,yksek kalitede veri oluturmak, veri kalitesi zerinde kontrolleri yapmak, modelleme ve analizleri ksa zamanda yapabilmek iin geoprocessing fonksiyonlarn kullanmaktadrlar. ArcToolBox geoprocessing aralarnn organize bir koleksiyonu, ModelBuilder ise geoprocessing i aklarnn yaplandrlmasndagrselbirmodellemedilidir. 41

ArcToolBox, ArcView, ArcEditor ve ArcInfo ierisinde kullanlabilir durumdadr. Her seviye ek geoprocessing aralar ierir. ArcView, basit veri yklemevednmaralarvetemelanalizaralariermektedir.ArcEditor, ArcView yazlmnn salad aralara ek olarak geodatabase oluturmaya ve yklemeye ynelik ek aralar salar. ArcInfo ise, ileri dzey analizler, veri dnm, veri ykleme ve coverage ilemleri iin ok kapsaml geoprocessingaralarsalar. ArcToolBox arayzne ArcGIS 10dan itibaren Search ve ArcCatalog pencereleriileulalmaktadr. ModelBuilder arayz ise, geoprocessing i aklarnn ve scriptlerinin yaplandrlmas iin grafiksel bir modelleme aracdr. Ayn zamanda karmak geoprocessingmodellerininoluturulmasnavetasarlanmasnayardmcolur. ModelBuilder, metodlar ve prosedrleri organizasyonunuz dndaki dier kullanclar ile paylaabilmeniz iin verimli bir mekanizmadr. Bunun tersi olarak, ArcGIS 10da gelen ifreleme ilemi ile oluturulan modellerin bakalartarafndaneriilmesideengellenebilmektedir.


ekil12:ArcToolBoxArayzne Searchpenceresindeneriim ekil13: ModelBuilderArayznde oluturulmuyerseimanalizimodeli

42

ArcGlobeveArcScene
ArcGIS Desktop 3D Analyst Modl ile birlikte gelen ArcGlobe ve ArcScene arayzleri, kullancya 3 boyutta modelleme, analiz ve ArcGIS 10dan itibaren gncellemeimkansunmaktadr..ArcGlobeveArcScenearayzlerinincorafi bilgi iin interaktif grntleme ortam, CBS kullanclarnn tamamen farkl verisetlerinientegreetmekabiliyetlerininemlildegelitirmitir.

ekil14: ArcGlobeArayz

ekil15: ArcSceneArayznde modellenmiarazivekent

ArcGISDesktopiinisteebalmodller
ArcGIS Masast Modlleri kullanlarak btn yazlmlara yeni yetenekler eklenebilmektedir.

ArcGIS3DAnalyst
Kullanclara etkin yzey modelleme, grntleme ve analiz imkan tanr. 3D Analyst kullanlarak eim, bak, grnrlk analizleri yaplabilir, vektr raster dnmleri gerekletirilebilir ve mekan 3 boyutlu olarak modellenebilmektedir. ArcGIS 3D Analyst Modl ile gelen ArcGlobe ve ArcScene arayzleri kullancya boyutta mekansal modelleme, gncelleme ve analiz imkan sunmaktadr.

43

ArcGIS 10dan itibaren kullanclar Phyton kullanarak bir ok analizi hzl olarakgerekletirebileceklerdir.

ekil16:ArcGISDesktop3DAnalystModlilegerekletirilmi3boyutlumodeller ArcGISSpatialAnalyst
ArcGIS Spatial Analyst byk lde gl mekansal modelleme ve hcre bazl raster verileri oluturmanza, haritalamanza, sorgulmanza izin veren analizlere sahiptir. Spatial Analyst ile kullanc mesafe, younluk analizleri gerekletirebilir, interpolasyon yapabilir ve aktrma analizleri

gerekletirebilmektedir.

44

ArcGIS 10dan itibaren 3D Analystte olduu gibi Spatial Analysttede kullanclar Phyton kullanarak analizleri hzl bir biimde

gerekletirebilmektedirler.

ArcGISNetworkAnalyst
ArcGISNetworkAnalyst,yolalarnngerekibirbiimdemodellenmesinive bu modeller zerinde gzergah analizleri gerekletirilmesini salamaktadr. En ksa yol, en yakn hizmetin bulunmas maliyet analizleri ve filo ynetimi gibitmaanalizleribumodlilegerekletirilebilmektedir. ArcGIS 10dan itibaren 3 boyutta da gzergah analizleri
ekil17: ArcGISDesktopSpatialAnalystModlilegerekletirilmi mekansalanalizler

gerekletirilebilmektedir.

45


ArcGISGeostatisticalAnalyst
ArcGIS Geostatistical Analyst modl, srekli verilerin analiz edilmesi ve haritalanmasna ynelik istatistiksel metodlar salamaktadr. Belirli noktalardan alnm deerlerden yzey oluturma aralar ile kullanc, deterministik ve jeoistatistiksel yntemleri kullanarak en doru yzeyi kolaylklaeldeedebilmektedir.
ekil18:ArcGISDesktopNetworkAnalystModlilegerekletirilmirotaanalizleri

46

ekil19:ArcGISDesktopGeostatisticalAnalystModlilegerekletirilmi

yzeyanalizleri
ArcGISTrackingAnalyst
ArcGIS Tracking Analyst, zaman ierisinde deiim gsteren veya yer deitiren objelerin haritalanmasnda kullanlmaktadr. Tracking Analyst ile gemi ve gelecee dair zamsansal analizler gerekletirilebilmekte ve bu deiimleranimasyonhalinegetirilebilmektedir.

ekil19:ArcGISDesktopTrackingAnalystModlilegerekletirilmianimasyonlar

47

ArcGISiinArcScan
ArcScan, 1 bit veya 8 bitlik taranm grntleri vektr tabanl katmanlara dntrebilmeniz iin aralar salarken ayn zamanda altnz grntnn raster hcrelerini semenize ve gncellemenize olanak tanmaktadr.


ekil20:ArcScanModlileharitannotomatikolaraksaysallatrlmas

ArcGISSchematics
ArcGIS Schematics modl, ArcGIS yazlm zerinde oluturulan a yaplarn kullanarak, geni alanlar zerindekiebekelerin tek hat ve prensipemalarn oluturmak iin kullanlmaktadr. ArcGIS Schematics, ArcGIS rnleri ile kurulmu olan elektrik,telekom, su, kanalizasyon ve doalgaz gibi altyap uygulamalarnn yannda lineer olan herhangi bir a yaps zerinde de kullanlabilmektedir.

48

ekil21:ArcGISDesktopSchematicsModlileoluturulmuotobshatlar ArcGISiinMaplex
Maplex modl, ileri dzey kartografik etiketlendirme iin hzl ve pratik zmler sunmaktadr. Maplex, yaz ve etiketler arasnda kabilecek akmalar zerken, teleme, yma, otomatik yaz tipi kltme, eikletirme ve ksaltma isimlerinin kullanlmas ile etiketlerin en uygun yerlerine yerlemesini samaktadr. Yksek kalitede kartografik sunumlar eldeetmekiinMaplexmutlakakullanlmaldr.
emalar

49

ekil22:MaplexModlileotomatikharitaetiketlendirmesi

ArcGISDataInteroperability
Data Interoperability modl, yaygn olarak kullanlan 150den fazla formatn ArcGIS formatna dnmn salamaktadr. Bu modln ana zellii, her bir CBS veri formatn direk eriilebilir veri kayna olarak ekleyebilmesidir. Ayn zamanda, ArcGIS kullanclar verilerini 80den fazla desteklenen veri formatnaexportedebilmektedirler. ArcGIS Data Interoperability modl, ESRI ve Safe Software ibirlii ile yaplandrlmtr. Yazlm Safe Softwarein popler FME rn zerine kurulmutur. ArcGISDataInteroperabilityModlilekullanclar; Standart FME formatlarn dorudan okuyabileceklerdir (TAB, MIF, E00,GML,..vs). 50

FME destekli veri tabanlarna balanabilecek ve bu veri taban balantlarndanokuyabileceklerdir(MySQL,PostGISgibi). FME birleik veri kaynaklarn tanmlayabilir ve bu kaynaklardan okuyabilirler. Veri taban ynetim sistemlerinden shape dosyalarna znitelik bilgilerinibirletirebilirler. Her feature class FMEnin destekledii veri formatlarna export edebilirler. ArcGIS destekli verileri her FME formatl veya destekli veri tabanna yklemek, ilemek ve export etmek iin geoprocessing yaps iindeki FMEortamnkullanabilirler.

ArcGISServer
ArcGIS Server yazlm kullancya, web zerinden masast ve mobil uygulamalar desteklemek iin, CBS servislerini oluturma, ynetme ve paylama kabiliyeti kazandrmaktadr. ArcGIS Server, gerek CBS uzmanlar iin, gerekse daha nce hibir CBS tecrbesi olmam alanlar iin, corafi bilgiye eriimi kolaylatrmaktadr. ArcGIS Server, uydu grntlerini de ieren mekansal verinin merkezi olarak ynetiminde, corafi verilerin kontrolnsalamaktadr. ArcGISDesktopgibi,ArcGISServerdaleklendirilebilirbirmimariyesahiptir. sterkkbirgrubuynetmekiin,isterbykbirkurumda,kurumiived ynetimi salamak ve corafi veri paylam yapmak iin ArcGIS Server farkl rnlersunmaktadr.

51

Hangi ArcGIS Server rnnn sizin iin uygun olduunu aadaki matrise bakarakbelirleyebilirsiniz.

ok kullancl bir ortamda corafi verinin ynetilmesi ii ArcGIS ve likisel Veri Taban Ynetim Sistemleri (IVTYS) arasnda paylalmaktadr. IVTYS, tablolarda bilgiyi tutmay ve ynetmeyi salamaktadr. ArcGISde corafi veri tabanlar IVTYSnin gcn kullanmaktadr; bu da kullancnn tercih ettii bir IVTYSde verileri depolama, ynetme, sorgulama ve paylama esneklii salamaktadr.AadaArcGISgenelmimarisigrnmektedir.
ekil25:ArcGISServerfonksiyonmatrisi

52

ekil26:ArcGIS Mimarisi

ArcSDETeknolojisi
ArcGIS9.2versiyonundannce,ArcSDEayrbirrnolaraksatlrken,9.2den itibaren ArcGIS Desktop ve ArcGIS Server platformlarna entegre edilmitir. ArcSDE teknolojisi CBS kullanclar ve IVTYS arasnda geit grevi yapmaktadr. Bu sayede IVTYS ierisindeki veriye eriilmesini ve verinin ynetilmesini kolaylatrmaktadr. ArcSDE aadaki tm IVTYS paketlerini desteklemektedir; DB2 Informix Oracle OraclewithSpatial 53

PostgreSQL SQLServerveSQLServerExpress

ArcSDEYetenekleri
likiselVeriTabanlarYnetimSistemlerineakbirarayzsalar. ok kullancl ortamda gncelleme yaplmasna ve geodatabase onarmyaplmasnaolanaktanr. Mekansal sorgulamalar ve detay davranlarn optimize eden yksek performanslbiruygulamasunucususalar. Verizerindetarihselolarakarivyapmaimkanverir.

ArcGISEngine
ArcGIS Engine,COM,.Net, Java, C++ ortamlarnda API (Application Programming Interface)ler kullanlarak geleneksel (masast ve mobil) uygulamalargelitimekiinkullanlmaktadr. ArcGISEngine; CBStabanluygulamalarhzlbirbiimdeyaplandrmakiin Grafikseldetaylarizmekveoluturmakiin Corafi ilemler gerekletirmek iin (tampon blge, kesiim noktalarnnbulunmasgibi) 3boyutluveriningrntlenmesiveanalizedilmesiiin Kodgalerineeriimvebukodlarkullanmakiingelitirilmitir.

ArcGISEngineaadakiplatformlardesteklemektedir.;

MicrosoftWindowsServer2003and2008 MicrosoftWindowsVista,XP,and2000 RedHat(EnterpriseLinux)AS/ES SUSELinuxEnterpriseServer SunSolaris

ArcGISEngineaadakirnleriiermektedir; 54

ArcGISEngineDeveloperKitfortheMicrosoft.NETFramework ArcGISEngineDeveloperKitfortheJavaPlatform ArcGISEngineDeveloperKitforCrossPlatformC++ ArcGISEngineDeveloperKitforCOM(VisualBasic6andVisualC++) ArcGISEngineRuntime

ArcGISEngineDevelopersKit
ArcGIS Engine Developers Kit, kullanc uygulamalarnn yaplandrlmasna ynelik, gelitirici bir kit olarak kullanlmaktadr. Bu kit, kullanc uygulamalarnn ierisine CBS fonksiyonlarn ieren gelitirme ortamna, kullanc arayz kontrollerini, aletleri ve yazlm ktphanelerini eklemektedir.zetleEngineDevelopersKit; Kontroller Araubuklarvearalar Yazlmktphanelerindenolumaktadr. Kontroller: Kullancnn ekledii ve uygulamalarnda kulland ArcGISin kullancarayzunsurlardr. Ara ubuklar : Kullanc uygulamalarnda haritalar ve corafi bilgi ile etkileimliPan,Zoom,IdentifyveSelectionaralarniermektedir. Yazlm Ktphaneleri : ArcObjects ktphanesidir. Bu ktphane ayn zamandaArcGISDesktopveArcGISServeriledekullanlabilmektedir.

ArcGISEngineRuntime
Uygulama gelitiricilerin ArcGIS Engien Developers Kit ile yazdklar uygulamalaraltrmakiingerekenktphanelergrubudur.

55

uygulamasrnei ekil27: ArcGISEngine

ArcGISveEndstriyelStandartlar
Corafi bilginin web zerinden hzla yaylabilmesi ve binlerce uygulama ve servise entegre edilebilmesi zerine CBS ak bir kavram haline gelmitir. ArcGIS kullanclarnn farkl platformlarla uyumlu alabilmeleri asndan, birokstandarddesteklemektedir. ArcGISITveGISstandartlarileaskeristandartlardadesteklemektedir. 56 Web:SOAP,XML,REST,JavaScript,KML,VirtualEarth OGC : GML, WFS, WMS, WCS (Daha fazla bilgi iin; www.opengeospatial.org ) EnterpriseIntegration:SOAP,XML,EJB,SQL ApplicationContent:CAD,Image,PDF

ArcGIS10Uygulamalar
Uygulama1:ArcMapeGiri
1. Balat>TmProgramlar>ArcGIS10>ArcMap10zerineift tklaynz. ArcMaparayzaldndakarnzailkolarakaadakipencere kacaktr. kt Harita ilemlerine hazrbir ablonu sadece okunabilir olarak grntlemek yadayenibir ablon oluturmakiin kullanlr. ArcGIS 10dan itibaren program ile oluturulan tm objelerin belirlenen dizinde saklanmas iin bir default geodatabaseoluturulmutur.

Bu blmde kullancnn daha nce zerinde alm olduu harita dkmanlar listelenmektedir. Kullanc dilerse buradan nceki harita dkmanlarn ap, zerinde almayabalayabilir.

2. BupencereyiOpenbutonunabasarakkapatnz. Getting Started penceresi kapandktan sonra ArcMap arayz ile karlaacaksnz. 57

MainMenu StandardToolbar ToolsToolbar 3. File mensnn altndan Opena veya Standard Toolbardaki Open ikonuna tklaynz. ArcGIS10_Egitim/Uygulama_01 dosyasnda yeralanUygulama_01.mxdyianz. Proje dosyas (.mxd) ierisinde yer alan veriler; Dnya lkeleri, Trkiyeilsnrlar,TrkiyeDemiryollarveYerleimlerkatmanlardr. TableofContents DataView/LayoutView ekran

ArcMapteSembolojiDeitirme;
4. ArcMap ortamnda Table of Contents mensnde yer alan katmanlarn renk ve semboloji deiikliklerini yapmak iin; Table of Contentsde yer alan Ulkeler katmannn poligon sembol zerinde mousensabutonunatklaynz.

58

5. Renk paletinden dilediiniz rengi seiniz. lkeler katmanna ait olan tm objelerin setiiniz rengi aldn greceksiniz. Ayn ilemi dier katmanlariindeuygulayabilirsiniz. 6. Semboloji deiiklii iin; Table of Contents mensnde yer alan Demiryolukatmannnizgisembolzerindemousensolbutonuna basnz.

7. Alan Symbol Selector penceresindeki RailRoad semboln seip rengini krmz, kalnln da 6 olarak ayarlaynz ve OK butonuna tklaynz.

59

8. Table of Contents mensnde yer alan Yerlesim katmannn nokta sembolzerindedemousensoltuunatklaynz. 9. Alan Symbol Selector penceresindeki Search kutusuna location monumentyazpenterabasnz.

10. LocationMonumentsembolnseipOKbutonunatklaynz.

60

ToolsToolbarFonksiyonlarilealma;
Zoom Fixed Zoom Select Elements FullExtent GotoNext HTML Find GotoXY

Zoom Pan Fixed ZoomIn GoBackto Previous Selection Identify Hyperlink Find Measure Viewer

TimeSlider

BuuygulamadaToolsToolbardakifonksiyonlarkullanlarakbirlke bulunacaktr. 11. FullExtent aracnatklaynzvetmverininekransnrna yerlemesinisalaynz. 12. ZoomIn aracylaAsyaktasnayaklanz.AradmzilklkeAsya ktasndabulunmaktadr.

61

13. Bu lke 93o 51 14.4 E ve 30o 17 6 N koordinatlarna sahip olan lkenin gneyindeki adalardan birisidir. Bu koordinatlara sahip olan lkeyibulmakiinGotoXY aracnatklaynz. 14. Alan Go to XY penceresine yukarda belirtilen koordinatlar yazp Enterabasnz.

15. Daha sonra bu koordinatlarn gneyine Zoom In yenidenyaklanz.

aracn seerek

16. lkeninadezyaharfleriilesonbulmaktadr.erisindeezyaharfleri bulunan lkeleri grntlemek iin Find aracna tklaynz. AadakiayarlaryapnzveFindbutonunatklaynz.

62

Findbutonunatkladktansonraaada2adetlkelistelenecektir. (EndonezyaveMalezya) 17. Aradmz lkenin nfusu 19.626.380, para tipi ise Ringgittir. Bu zellikleri grntlemek iin ncelikle Endonezya zerinde sa tklaynzveZoomtoseeneinetklaynz.

18. Dahasonraidentify aracnseinizveEndonezyazerindetekrar tklaynz. Alan Identify penceresindeki nfs ve para tipi kaytlarn kontrolediniz.

63

Bu kontrol sonrasnda Endonezyann aradmz kriterleri karlamadngreceksiniz. 19. Identify penceresinin yerini deitirirken ekranda kan oklarn zerine getirerek arayze yerlemesini salayabilirsiniz. Bu sayede identify penceresinin kullanlmad durumlarda saklanmasn salamolursunuz.

64

20. IdentifyaracylabuseferMalezyazerinetklaynzveidentify penceresindenverilenkriterlereuygunolupolmadnkontrol ediniz. KontrolsonucundaaradmzlkeninMalezyaolduuanlalacaktr. 21. Bu aamada Malezyann fotoraf eklenecektir. Bunun iin Identify penceresindeki MY ad zerinde sa tklaynz ve Add Hyperlinki seiniz.

22. Alan pencerede butonuna tklaynz. Eklemek istediimiz resim ArcGIS10_EGITIM > Uygulama_01 > Hyperlink dizinin ierisindeki Malezya.jpg dosyasdr. Dosyay seip Open aracna daha sonra OK butonunatklaynz.

23. Bu ilemden sonra Tools Toolbardaki Hyperlink arac aktif hale gelecektir.Hyperlinkaracnatkladktan sonraMalezyazerinetekrar tklaynz.Resminekrandaaldngreceksiniz. 65

Resmikapatnz. 24. stenilen bir web sitesini ekran zerinde tklandnda grntlemek iinse HTML Popup fonksiyonu kullanlmaktadr. Bunun iin Table of Contentsde bulunan Ulkeler katmannda sa tklaynz ve Properties seeneinetklaynz.

66

25. Alan Layer Properties penceresinde HTML Popup sekmesine tklaynz ve ayarlar aadaki ekildeki gibi yapnz ve OK butonuna tklaynz.

67

26. Daha sonra Tools Toolbardaki HTML Popup aracna tklayp, Malezya zerine tekrar tklaynz. Web sitesinin aldn greceksiniz.

Alanpencereyikapatnz. 27. Malezyaya bir sonraki uygulamada tekrar geri dnmek iin,u anda ekranda olan grnty Bookmark olarak kaydetmemiz gerekmektedir. Bunun iin Main Menudeki Bookmarks mensnn altndanCreateseeneinetklaynz.

28. AlanBookmarkpenceresindeBookmark1yazanyereMalezyayazp OKbutonunatklaynz. 29. ArcMapikaydetmedenkapatnz. 68

Uygulama2:ArcMapteRasterVerilerinGrntlenmesi;
Raster Veri hcrelere bal olarak temsil edilen verilerdir. En kk birim piksel olarak tanmlanmaktadr. Raster verilerde verinin hassasiyeti piksel boyutuna gre deien znrlk (resolution) zellii ile tanmlanmaktadr.

Bu uygulamada, Trkiye ve komularn ieren 1km hassasiyette retilmiolanSaysalYkseklikModelinin(DEM)snflandrlmasveTrkiyeil vektrel katmanna transparanlk zellii katlarak verilerin birbirleri ile etkileimliolarakgrntlenmesisalanacaktr. 1. Balat>TmProgramlar>ArcGIS>ArcMap10uanz. 2. ArcGIS10_EGITIM/Uygulama_02 dosyasnn ierisinde yer alan Uygulama_02.mxdyianz. TableofContentsdeTurkiye,Turkiye_demveTurkiye_hillkatmanlar bulunmaktadr. Ancak sadece Turkiye_hill katmannn eki atl olduuiinbukatmanDataViewpenceresindegrntlenmektedir.

69

VektrelKatman RasterKatman;DEM(DigitalElevation Model Saysal Ykseklik Modeli ) : GRID formatndaki bu tr veriler VAT (Value Attribute Table) dosyasnda x,y koordinatlar ve ykseklik bilgilerini iermektedir. Raster Katman; Hillshade (Kabartma Haritas ) : Kabartma haritalar DEMden oluturulmakta ve sadece arazi toporafyasntemsiletmesiiinkullanlmaktadr.Ykseklik bilgisiiermez 3. Table of Contentsde bulunan Turkiye_dem katmannn ekini atarak grntlenmesinisalaynz.

4. Table of Contentsde bulunan Turkiye_dem katman zerinde mousensatuunatklaynzvePropertiesseeneinetklaynz. 70

5. Alan Layer Properties penceresinde Symbology sekmesini tklaynz. 6. Color ramp mensnden dilediiniz bir renk araln seip, Display Background Value kutusunun ekini atnz ve as mensnden ykseklikdeerisfrolanyerler(denizler)iinmavirenginiseiniz. 7. Apply butonuna basnz. Trkiye_dem katman ykseklik deerlerine gre renklendirilmi oldu. Turkiye_hill katmannn da ykseklik haritas altnda toporafyay gstermesi iin Turkiye_deme effaflk vermekgerekmektedir.

71

8. Katmana transparanlk vermek iin Display sekmesine tklaynz. Transparency kutusuna 50 rakamn giriniz. Bu ilem, katmann %50 effafolmasnsalayacaktr.

9. OKbutonunabaspyaptnzdeiikleriinceleyiniz. 72

HaritayaBaseMapEklenmesi;
Haritalar olutururken kullancnn amac, yksek performansl ve yksek kalitede kartografik sunumlar elde etmektir. ESRInin sunduu Basemap haritalar bu tr sunumlar elde etmenin en kolay yollarndan birisidir. 1. Table of Contens mensndeki turkiye_dem ve turkiye_hill katmanlarnnekinikaldrp,turkiyekatmannnekiniatnz. 2. AddDatamensndenAddBasemapseeneinetklaynz.

Alan pencerede ESRInin sunmu olduu ve haritalarnza altlk olarakkullanabileceinizBasemapharitalarlistelenmektedir. 73

3. ListedenBingMapsAerialaltlnseipAddbutonunatklaynz. 4. Ankaraya Zoom in aracyle yaklanz. Microsoftun sunmu olduu Bing Maps haritalarn cretsiz olarak haritanzn altnda grntleyebileceinizigrmektesiniz. 5. ArcMapikaydetmedenkapatnz.


74

Uygulama3:VektrVeriTipleri(Shapefile,Coverages,Feature ClassveCAD);
Vektr veri, noktalara (x,y) bal olarak temsil edilen verilerdir. Konumaaitverilerin,nokta,izgivealanzelliklerix,ykoordinat deerleriyle depolanmaktadr.Noktazellii,tekbirx,ykoordinatiftiiletemsiledilmekte (Elektrik direkleri, kuyu noktalar, yangn musluklar gibi); izgi zellii,bir balang ve bir biti noktas olan x,y koordinat dizisi ile temsil edilmekte(dere, yol, elektrik hatlar gibi); alan zellii ise, balang ve biti noktas ayn olan x,y koordinatlar dizisi ile temsil edilmektedir (parsel, bina, arazikullanmgibi).

Vektrel veriler iin iki temel depolama yntemi vardr: Spagetti ve Topolojikverimodelleri SpagettiVeriDepolamaYntemi; Spagetti veri depolama ynteminde, nokta, izgi ve alan trndeki vektr veriler, temsil ettikleri detay oluturan nokta ya da noktalar kmesi eklinde detay tanmlayan tek anlaml bir kod (detay kodu) ve detay tr (nokta, izgi, alan) ile birlikte depolanr. Ayn ya da farkl detaylarn akmas ya da komu olmas durumlarnda ortak kenar ve/veya noktalar her detay tekrarlanarakdepolanr. 75

TopolojikVeriDepolamaYntemi; Topolojik veri depolama ynteminde, detaylar arasndaki komuluk, yn,akma,balantgibimekansalilikilertanmlanr.Ayrcakomu,kesien ve akan detaylarn ortak nokta ve kenarlar bir kez daha depolanarak, spagetti ynteminde karlalan binme, boluk, kopukluk tama gibi gibi geometrikhatalarelemineedilmiolur. ESRI vektr formatlar (Coverage, Shapefile ve Feature Class) topolojikverimodellerinebirerrnektir. Bu uygulamada, vektrel verilerin grntleme zellikleri (Layer Properties ve Data Frame Properties) ve harita kt ilemleri gerekletirilecektir. 1. ArcGIS10_EGITIM/Uygulama_03doyasndayeralan Uygulama_03.mxdyiArcMap10daanz. Table of Contentsde Ankara kyler, Trkiye il merkez, Trkiye demir yollar, Trkiye nehir, Trkiye otoyollar, Trkiye gller ve Trkiye il vektrel katmanlarnn olduunu greceksiniz. Ayn zamanda Bir nceki uygulamada bahsedilen Trkiye Hillshade (kabartma) ve Trkiye DEM (ykseklik modeli) raster verileri de yer almaktadr. Bu katmanlar zerinde Layer Properties penceresi kullanlarak deiikler yaplacakveharitaktyahazrlanacaktr.

KatmanzellikleriPenceresi;
Uygulama_03.mxd ierisinde Table of Contentsde bulunan vektr ve raster verilere ait katman zellikleri (Layer Properties) penceresi bulunmaktadr. Bu pencerede verinin Raster veya Vektr veri olmasna gre deien sekmeler gelmektedir. Aadaki ekran kopyasnda grnd ekilde bir vektr verinin katman zelliklerinden General, 76

Source, Selection, Display, Symbology, Fields, Definition Query, Labels, Joins&Relates,Time*,HTML Popup seenekleri ayarlanabilir. Raster verilerin katman zelliklerinde ise Selection, Label ve Definition Query seenekleri veri yapsnn vektr veriden farkl olmasndan dolay bulunmamaktadir. 2. lk olarak Table of Contentsde bulunan katmanlarn katman isimleri deitirilecektir. Bunun iin Table of Contentsde bulunan herbir katman zerinde mouseun sa tuuna tklayarak Layer Properties seeneine geliniz. General sekmesinde bulunan Layer Name ile katmanadndeitiriniz.Deiiklikleriaadakigibiyapnz; Turkiye_AnkKoy AnkaraKyler TrkiyelMerkezleri Turkiye_ilMerkez Turkiye_Demiryolu Demiryolu Turkiye_Nehir Nehir Turkiye_Otoyol Otoyol Turkiye_Gol Gl Turkiye_il lSnrlar Turkiye_Dem YkseklikKuaklar Turkiye_hill TrkiyeKabartma

77

3. Ykseklik Kuaklar katmannn katman zelliklerinde Display sekmesine geliniz. Burada katmana ait grntleme zelliklerini dzenleyebilirsiniz. DEM katmannn ykseklik kuaklarna ait semboloji ile kabart haritasnn birlikte grsellik kazanmas iin Table of Contentsde stte bulunan Ykseklik Kuaklar katmannn Transparentksmn%50olarakayarlaynz.

78

4. Displayin hemen yannda bulunan Symbology sekmesini tklaynz. Burada Ykselik Kuaklarnn renk araln deitiriniz. Color Ramp seeneini tklayarak renk tanmlamas yapnz (13. Srada bulunan renk aral). Display Background Value zelliine ait tiki atnz ve kutucuk iinde 0 yazdndan emin olunuz, baka bir deer yazyorsa 0(sfr) yaznz ve as seeneini mavi deer olarak belirleyiniz. Bu ayarlamalar ile DEM haritasnda ykselik deeri 0 olan yerleri(denizler 0 kotundadr) mavi renkte gstermektesiniz. OKi tklaynz.

79

5. Gl katmannn semboln deitirmek iin ona ait sembol zerinde mouseun sol tuuna basnz. Karnza alan Symbol Selector penceresindenLakesembolnseerekOKetklaynz.

6. Demiryolu katmannn semboln de ayn ekilde altndaki sembole tklayarak deitiriniz. Fakat bu sefer alan Symbol Selector penceresinde yukarda bulunan arama boluuna (Type here to 80

search) Railroad yazarak klavyenizden Entera tklaynz. Sembol penceresinde isminde railroad bulunan tm semboller ekrana gelecektir. Pencereyi aaya doru kaydrarak ESRI semboloji ktphanesi altnda bulunan railroad semboln seiniz ve OKe tklaynz.

7. Nehir katmannn da ayn ekilde semboln tklayarak Symbol Selector penceresindeki River semboln seiniz. Eer River semboln ilk atnz ekranda gremiyorsanz arama kutucuundan aratarakbulabilirsiniz. 8. l snrlar katmannn semboln deitirmek istiyoruz fakat bu deiiklii l isimlerine gre yapmak istiyoruz. Bunun iin l Snrlar katmanzerindesatklayarakPropertiesiseiniz. Alan Layer Properties penceresinde Symbology sekmesini seiniz veCategoriesaltndabulunanUnique Valuesfonksiyonunutklaynz. Value Fieldolaraklsnrlarkatmannnzniteliktablosundabulunan ADIdeeriniseiniz.

81

Adna gre sembolojiyi kategorize etmek iin Add All Values butonuna tklaynz. Bylece seilen renk aralna gre tm deerler ayr ayr kategorizeedilmiolarakekranagelecektir.Applybutonunatklaynz. 9. l snrlar katmannn Layer Properties penceresinde Display sekmesini tklaynz ve Transparent ksmndan %50 effaflk ayarlaynz. Show MapTips using the display expressionseeneininyanndaki kutucua tik atnz ve hemen stndeki Field fonksiyonuna ADI deerinigetiriniz.Applybutonunatklaynz. ArcGIS 10 verisonundan itibaren birden fazla znitelik deerine gre, MapTipszelliiExpressionyazlarakeklenebilmektedir.

82

10. l snrlar katmannda Labels sekmesine tklaynz. Bu ilem ile, il snrlar alan katman zerine znitelik tablosundaki deerler yazdrlabilecektir. Bu etiketlendirme ilemini yapabilmek iin Labels sekmesinde Label features in this layer ifadesinin yanndaki kutuya tik atnz. Text String fonksiyonunda etiketlendirmeyi hangi znitelik deerine gre yapmak istediinizi belirleyebilirsiniz. l isimlerini katman zerine etiketlendirme yapmak iin Label Field olarak ADI fieldnseiniz.

11. EtiketinkatmanzerindekisembolduruunudeitirmekiinSymbol aracnatklaynzveistediinizbirTextsembolnsetiktensonraOK butonunatklaynz. 12. Yaptnz deiiklikler ekranda grntlenmektedir. Tools ara ubuunda bulunan Zoom In ve Zoom Out aralarn kullanarak deiiklikleri inceleyiniz. Show MapTips fonksiyonu ile Labels arasndaki farklar incelemek iin mouse il snrlar zerinde bir yerde sabittutunuz. 13. Tm deiiklikler ile birlikte altnz projeyi File > Save As ile C:/ArcGIS10_EGITIM/Uygulama03/Uygulama03_1.mxd olarak kaydediniz.ArcMapikapatnz. 83

Joins&Relates&Symbology;
Adm1:Joins
1. ArcMap10dabobirprojesayfasanz. 2. aracn tklayarak C:/ArcGIS10_EGITIM /Uygulama03/Turkiye.mdb personal geodatabase iinde bulunan Turkiye_ilpolygonfeatureclass,Trkiye_Nufus2000,Turkiye_Saglik, Turkiye_Secim95 tablolarn klavyeden CTRL tuuna basl haldeyken okluolarakseiniz.Addbutonunatklayarakekleyiniz.

3. Grafiksel olmayan tablo verileriyle birlikte katmanlar eklendiinde Table of Contentsdeki men seenei List By Drawing Order dan List By Source a otomatik olarak deiir. Bunun nedeni, sembolojisini deitirebileceimiz grafiksel verilerle beraber sadece znitelikdeerleriolantablolarndaArcMapeeklenebilmesidir.

84

4. Tools ara ubuundaki Identify aracyla Trkiye_il katmanndan Eskiehiri tklaynz. Identify penceresinde Turkiye_il znitelik tablosunda Eskiehirin bulunduu veritaban bilgilerini Identify Result penceresine getirmektedir. Identify penceresinin mavi bal zerinde mousea basl haldeyken ekran zerinde bir yere tayabilirsiniz. Dier pencere arayzleri gibi Identifyda otomatik olarakarayzeyerletirilebilirvegerektiindesaklanabilmektedir.

5. Trkiye_ilkatmannnveritabanndaADI,YERLESIMKO,ILvs.bilgiler bulunmaktadr.AynekildeNufs2000tablosuzerindesa tklayarakzniteliktablosunuanz. 85

6. 2000 ylna ait nfus tablosu aadaki gibidir. Bu tablo ierisinde IL, ILADI, NUFUS_2000 ve YERLESIMKOD fieldlar bulunmaktadr. Trkiye_il katmannnda znitelik tablosunu anz. Turkiye_il tablosu ile Nufus2000 tablolarn Join ile birletirmek iin ortak bir fielda ihtiyacmzvardr.

Turkiye_il katman znitelik tablosuna Turkiye_Nufus2000 tablosunu join etmek iin kullanlacak ortak field YERLESIMKOD stunudur. Deerleri kontrol ettiimiz zaman ayn illerin ayn yerleimkod deerine sahip olduklar grlecektir.

86

7. Turkiye_ilkatmanzerindemouseilesatklayarakLayer Properties penceresini anz. Joins&Relates sekmesini tklaynz. Joins ksmnda Addbutonunatklaynz.

Alan pencerede ayarlar stteki gibi yapnz ve Validate Join butonuna tklaynz. ArcGIS 10 ile gelen bu zellik ile, Join ilemini yapmadan nce ortak fieldlarn eleme durumunu, veritabanlarn kolaylklakontroledebilirisiniz.Verilerineletiindeneminolduktan sonraOKbutonunatklaynz. 87

8. Nufus2000 tablosu Turkiye_il katmanna geici olarak eklenmitir. Aynekilde Turkiye_Secim95 ve Turkiye_Saglik tablolarn da join ile ekleyiniz.

9. Layer Properties ekrannda OK butonuna tklaynz. Identify aracyla yeniden Eskiehir ilinin zerine gelip tklaynz. Saklanan pencere olarak ayarladnz Identify penceresi ekrann sanda tekrar alacaktr. Identify Result penceresinde daha ok kaydn eklenmi olarakgeldiinigreceksiniz.

88

Adm2:Symbology
1. Table of Contentsde 2000 ylna ait nfus verileri 1995 ylna ait seim verileri ve salk verileri eklendikten sonra men grntsn tekrar List By Drawing Order olarak deitiriniz. Bunun iin Table of Contentsde simgesinitklaynz. 2. Turkiye_ilkatmanndabulunanillerinhepsiuandatekbirsembolile gsterilmektedir. Join ile eklenilen Nfus 2000 deerine gre tematik harita oluturmak iin katman zerinde sa tklayp Layer Properties penceresinianz.Symbologysekmesiniseiniz. 3. Saysal znitelik deerlerine gre tematik harita oluturmak iin Quantitiesi tklaynz ve Graduated Colors zelliini seiniz. Value FieldolarakNUFUS_2000zniteliiniseiniz.

89

4. l snrlar 2000 yl nfusuna gre belirtilen renk aralnda 5 snfta dereceli olarak renklendirilmitr. (stee gre Classification zelliinden snf saysn arttrabilir veya azaltabilirsiniz). Range ve Label seeneklerinde ise mouse ile tkladnz zaman bu deer aralklar iinde istediiniz ekilde deiiklik yapabilirsiniz. Label blmnde yaplacak deiiklik haritanz ktya hazrlarken(layout) Lejant olarak gsterilecei iin harita kts grsellii asndan aadakigibiayarlaynz.

5. OKetklaynz.TurkiyeNfusDalmharitasoluturulmutur.

90

6. Insert mensnden Data Frame seeneini tklaynz. Veritabanna join edilmi ekilde veriler Turkiye_il katmanndabulunduundandolaybukatmanzerindesatklayarak Copy butonunu seiniz ve yeni oluturduunuz New Data Frame zerindesatklayarakPasteLayeratklaynz. 7. Yeni veri erevesine kopyalanan Turkiye_il katmannda Kii bana den Hekim says tematik olarak gsterilecektir. Bunun iin katman zerinde sa tklayarak Layer Propertiesi anz ve Symbology sekmesiniseiniz.

91

8. Quantites > Graduated Colors zelliini seiniz. Value Field olarak HEKIM zniteliini, Normalization olarak da NUFUS_2000 zniteliini ayarlaynz. OKi tklaynz. Bylelikle Nfusa gre Hekim saysn gsterenilktematikharitanzeldeetmiolacaksnz.

Farkl Data Frameler zerinde almak, ayn kt sayfasnda birden fazla harita oluturmaya yardmc olur. Baka alma alan zerinde almak istendii zaman baka bir ArcMap arayz amak yerine Data Frameler eklenerek tek ArcMap arayz zerinde birden fazla harita grntlemesi yaplabilir. Data Frameler aras gei Active butonu ile salanr. Hangi veri erevesi Data View ekrannda

92

grntlenmek isteniyorsa o Data Frame zerinde sa tklanarak Activateseilir.

9. Aktif yaptnz Data Frame zerinde sa tklayarak Propertiesi seerekData Frame Propertiespenceresinianz.Generalsekmesini seiniz ve Name ksmna Nfus yaznz. OKi tklamadan nce veri erevesi olarak hangi zelliklerin bulunduunu inceleyiniz. rnein, Nfus veri erevesi Decimal Degrees biriminde grntlenmektedir. OKetklaynz.

93

10. Ayn ekilde New Data Frame zerinde sa tklayarak Propertiesi seiniz ve General sekmesinden Name ksmna Salk yaznz. OKi tklaynz. Salk veri erevesi zerinde sa tklayarak Activate seiniz. Bylece Salk veri erevesi aktif olur ve bu veri erevesi altnda bulunan harita veya haritalar Data View ekrannda grntlenir.

94

11. Insert> DataFrameseerekNewDataFrame2adndayenibirveri erevesi ekleyiniz. Yukardaki Nfus ve Salk veri erevelerinden herhangi birinde bulunan Turkiye_il katman New Data Frame 2ye kopyalayp yaptrnz. (pucu: Bu ilem Salk veri erevesini oluturmakiinyaplmt.) 12. Kopyalanan Turkiye_il katman zerinde sa tklayarak Propetiesi seiniz.AlanLayer PropertiespenceresindeSymbologysekmesinde Charts > Pie ksmna tklaynz. Field Selection ksmnda Turkiye_il katman znitelik fieldlar grntlenmektedir. Burada seeceiniz partileri>simgesinitklayaraksandakikutucuataynz.Bylece seilen partilerin oy dalmlar Pasta Dilimi sembolyle ekranda grntlenecektir.

95

13. Ayn ekranda Size butonuna tklaynz. Tm pasta dilimi sembolleri ayn boyutta (32pt) grntlenmektedir. Fakat semen saysna gre bu sembollerin de bykln deitirmek iin Vary Size using a fieldolarakSECSAYfieldnseiniz.OKitklaynz.

96

14. Layer Properties ekrannda OKi tklaynz. Bu veri erevesinin adn Seim olarak deitiriniz. (pucu: Nfus ve Salk veri erevelerinin adlarndeitirmekiinyaplmt.) 15. Insert> DataFrameseerekNewDataFrame3adndayenibirveri erevesioluturunuz.Turkiye_ilkatmanntekrarbuverierevesine kopyalayp yaptrnz. Yaptrdnz Turkiye_il katmann Layer PropertiespenceresiniaarakSymbologysekmesinitklaynz. 16. Quantities> Graduatedsymbolsksmnseiniz.Nfusagredeien semboller ile tematik gsterim iin bu seim yaplmtr. Value Field olarakNUFUS_2000zniteliiniseiniz.OKitklaynz.

17. New Data Frame 3 olan veri erevesinin adn Nfus2 olarak deitiriniz.

97

Table of Contentsde 4 farkl veri erevesi ve 4 farkl harita oluturulmutur. Bu haritalar bir sonraki uygulamada ktya(Layosut) hazrlanacaktr. 18. File > Save As tklayarak projeyi C:/ArcGIS10_EGITIM/ Uygulama04/Layout.mxdolarakkaydediniz.ArcMapikapatnz.


98

Uygulama4:HaritalarnKartografikretimi,kt(Layout);
Bu uygulamada, bir nceki uygulamada 4 farkl veri erevesinde hazrlam olduunuz haritalardan, Corafi Bilgi Sistemlerinin genel ilevleri arasnda bulunan ktya hazrlama fonksiyonu uygulamas yaplacaktr. Data View ekrannda hazrlanan haritalarn, tanmlanan semboloji ve etiket bilgileriyle birlikte lek deerlerine gre ktya hazrlanmas ve kat haritalareklinde kt olarak kullanlmas ilemine Layout denilmektedir. ArcGISde bu ilem iinLayoutViewekrankullanlmaktadr. 1. Balat > Tm programlar > ArcGIS > ArcMap 10 tklaynz ve bir nceki uygulamada hazrladnz Layout.mxd projesini anz. (pucu: C:/ArcGIS10_EGITIM/Uygulama04/Layout.mxdkaydedilmiti.) 2. Layout.mxd 4 farkl veri erevesinde oluturulmu haritalar iermektedir. Sembolojilerini deitirdiimiz bu haritalar Data View ekrannda veri erevelerini aktif ederek teker teker grntleyebilmekteyiz. ktya hazrlamak iin kullanacamz ekran olan Layout View ekranna gemek iin menlerden View > Layout View seeneine tklaynz. Ya da ksayol olarak ArcMap arayznn altndaki Data View ve Layout View ekranlar arasnda geii salayan simgelerdenLayoutView aracnatklaynz.

3. Alan sayfada, oluturulan tm veri ereveleri iinde bulunan haritalar ekranda st ste gelirler. Haritalarn, ktya hazrlamak istediimiz ekilde sayfa boyutu iine sdrlmas gerekmektedir. Bununiinncesayfave printerayarlaryaplmaldr.File > Page and Print Setup seiniz. Alan pencerede Use Printer Page Settings 99

seeneine ait tiki kaldrnz ve hangi sayfa boyutunda kt hazrlanlmas isteniyorsa ona ait ayarlamar yapnz. Orientation seeneini Landscape yaparak sayfann yatay durmasn salaynz. OKetklaynz.

4. Hangi veri erevesine ait harita zerinde ilem yaplmak isteniyorsa, o ereveyi (Lejant, lek, balk ekleme vs) Select Elements ile zerinde bir kez tklayarak seili duruma getiriniz. Seili olan veri erevesi hangisi ise Table of Contentsde koyu renkli olacakekilde aktif olur. Nfus, Seim, Salk ve Nfus2 haritalarn sayfa ierisine yerletiriniz.

100

5. Layout Viewda seili olan veri erevesi Table of Contentsde Koyu harflerle belirtilen Seimdir. ktya eklenecek olan harita objeleri (Kuzey Oku, Lejant, lek vb.) hangi veri erevesindeki haritaya eklenecekseekildekigibiseiliolmaldr.ekildeSeimverierevesi aktifdurumdadrvebuverierevesineaitktobjelerieklenecektir. kt ilemi iin kullanlacak objeler (Kuzey Oku, Lejant, lek vb.) Insert mensnden eklenir. Bu men kt objelerini eklemeyi saladndan dolay sadece Layout View ekrannda aktif olarak kullanlmaktadr. 6. Insert > Title seiniz. Bu ilem ktya hazrlanacak haritaya balk eklemeyisalar. Insert > North Arrow seiniz. Alan pencerede Kuzey oklarnn bulunduu sembol ktphanesi gelir.Kullanmak istediiniz kuzey okunu seiniz ve sonra veri erevesi zerinde uygun bir yere yerletiriniz. stee gre kuzey oku grafii zerinde Select Elements ileifttklayaraka,yngibideiiklikleryapabilirsiniz.

101

Insert > Scale Bar seeneine tklaynz. Seili olan veri erevenizin Layout View ekrannda grntlenen leine gre izgisel lek oluturacak sembolojiler ekrana gelmektedir. stediiniz izgisel lek semboln seiniz. lein birimi veri erevesinin birimi olarak gelecektir; deitirmek iin Select Element ile ift tklaynz ve Divisions Units ksmndanKilometreolarakdeitiriniz.

102

Lejant eklemek iin Insert > Legend seeneine tklaynz. Alan pencerede lejant olarak hangi katmanlarn grntlenmesini istediinizi seiniz.AadakiekildekigibiayarlamalaryapnzveFinishitklaynz.

Oluan lejant zerinde grafiksel bazl obje deiiklikleri yapmak iin lejant zerinde sa tklayarak Convert to Graphics fonksiyonunu seiniz. Daha sonraUngroupseeneiyledeiiklikleryaplabilmektedir. 7. Her bir veri erevesi iin bu dzenlemeleri teker teker ayarlaynz. Haritalaratemelktobjelerinitanmlaynz. 103

8. Insert > Dynamic Text > Coordinate Systemseeneineyklaynz.Bu ilem veri erevelerinin tanmlanan koordinat sistemini bilgi olarak kt sayfasna ekler. Uygulamada bulunan 4 veri erevesinin de koordinat sistemleri ayn olduundan bir tane tanmlanmas yeterli olacaktr. Insert > Dynamic Text > Author seeneine tklaynz. Bu ilem ile haritay hazrlayan kii veya kurumlar otomatik olarak ekleyebilirsiniz. Insert > Dynamic Text > Current Date seenei ile de haritann hazrlandtarihisayfayaekleyiniz.

104

9. Haritann ktya hazrl tamamlandktan sonra farkl formatlarda kaydetmek iin File > Export Map seeneine tklaynz Layout.jpeg dosyas olarak Masastnze kaydediniz. Oluturduunuz projeyi kaydederekkapatnz.


105

Uygulama5:SembolojiKtphanesi(Style);
ArcGIS Teknolojisi (ArcView,ArcEditor ve ArcInfo iin) kullanclarna geni bir semboloji ktphanesi sunmaktadr.Semboloji ktphanesi ArcGIS ierisinde Style olarak adlandrlr. ArcMap arayznde nokta, izgi, tarama, renk, lek ubuu, kuzey oku, ereveler, yaz tipleri gibi zellikler ve bu zellikleri ieren ok sayda farkl semboloji bir ktphane ierisinde depolanr ve ArcGISteknolojisisayesindeprogramierisindekullanmsalanr. Yeni bir semboloji ktphanesi tanmlandktan sonra ArcMap arayznde yer alan aralar yardm ile semboller oluturulur.Semboloji ktphanesi yardm ile yeni sembollerin oluturulmas,sembollere verilen isimlerle, herhangi bir katmann veritabannda yer alan belli znitelikleri eletirilerek ,istenilen znitelie gre semboloji atanmas ilemi otomatik olarak gerekletirilmi olur.

106

1. ArcGIS10_Egitim/Uygulama_05dosyasndayeralan Uygulama_05.mxdyiArcMaparayzndeanz. 2. MenuBardanCustomize>StyleManagerfonksiyonunageiniz Style Manager Penceresinden, sistemde halihazrda yer alan ktphaneleri grebilir veya daha nceden kullanclar tarafndan eitli amalarla oluturulmu olan ktphaneler yardmyla yeni bir ktphane dosyas oluturabilirsiniz.altnz kurum ya da kuruluun kendine ait logo,sembol veya tasarmlarn bu ekilde ArcGIS semboloji ktphanesine ekleyebilir ve amalardorultusundakullanabilirsiniz.

107

Bu uygulamada, ncelikle Jeoloji.style dosyasnn Formasyon katmannn veri tabanndaki Aklama fieldna gre otomatik olarak elemesi salanacak, daha sonra kullanclarn kendi sembollerini nasl oluturacaklar gsterilecektir.

108

3. Style Manager Penceresinden Styles butonuna basnz. Alan Style References penceresindeki Add Style to List seeneine tklaynz ve daha nceden hazrlanan Uygulama_05/Style klasrnde yer alan Jeoloji.styledosyasnseinizveOKbutonunatklaynz.

4. Add Style to List ileminden sonra Style Manager penceresinde yer alan Jeoloji.style ktphanesindeki Fill, Line ve Marker Symbolleri inceleyelim.

109

5. Style Managerdaki Jeoloji.style ktphanesindeki Fill Symbol klasrn mouse ile seiniz.Sembollerin yer ald alanda mouseun satuunabasarakNew>FillSymbolzelliiniseiniz.

110

6. EkrandaalanSymbolPropertyEditorpenceresisizeJeoloji.style ktphanesindeyenibirtaramasembolojisioluturmakiinimkan tanrkenaynzamandayineburadan,bilgisayarierisindekiresimtipi bitmapolanbirdosyayJeoloji.stylektphanesineeklemeyide salamaktadr.Bilgisayarnzdanbirsemboleklemekiinyapmanz gereken;TypePictureFillSymbololarakayarlayp,bilgisayar ierisinden(C:\ArcGIS10_Egitim\Uygulama_05\Style\sembol.bmp) ilgiliresimdosyasnsemektir.DahasonraSymbolProperty Editorderesminzerindeistenilendeiiklikleryaplabilir. BilgisayarnzdanbitmapresimdosyasnseipOpenbutonuna basnzvedahasonraOKetklaynz.

7. OluansembolnadnBazaltolarakayarlaynz. Uygulamann banda ArcMap arayznde, Style Ktphanesinden yararlanarak otomatik olarak sembollerin eletirilebileceinden bahsetmitik. Bu ilemin gerekleebilmesi iin Style dosyasndaki sembollerin isimleri ile katmann ilgili znitelik stnnda yazan ifadelerbirebiraynolmaldr.

111

8. imdi de ESRI.style ktphanesinde tanmlanm bir izgi sembol olan Railroadu seip mouseun sa tuuna basarak Copy fonksiyonuyla kopyalaynz. Style Managerda Jeoloji Style ktphanesine geerek Line Symbol ierisine Paste fonksiyonu ile yaptrnz. Semboln adn Demir Yolu olarak (rename) yeniden adlandrnz.

9. ClosebutonunatklayarakStyleManagerpenceresinikapatnz. 10. Jeolojik Formasyonlar katmanna ait Layer Properties mensnde Symbology sekmesine tklaynz.Bu sekmede; Value Field ACIKLAMA

112

olacak ekilde Match to Symbols in Style ksmndan Jeoloji.style dosyasnseipMatchSymbolstuunabaspOKitklaynz.

Bu ilem ile Jeoloji.style dosyasnda oluturulmu olan semboller Formasyon katmannn aklamalar ile eleerek olmas gereken sembolojiyikazanmoldu.

113

11. Ayn ilemleri Table Of Contentsdeki Yollar Katman iin yapalm. Yollar Katmanna ait Layer Propertiesden Symbology sekmesine geiniz.Categories altnda yer alan Match to symbols in a Style fonksiyonunu ayarlaynz. Value Fielda, Aciklama, Match to symbols inStylea,Jeoloji.stylektphanesiniayarlaynz.SonradaOKtuuna basarak ilemi sonlandrnz. Bylece Style dosyasndaki semboller, katmann Aciklama stnundaki isimlerle eletirilerek otomatik olarakatanmolacaktr.

114

12. Tabaka Dorultu Katmanna ait Layer Properties mensnde Symbology sekmesine geiniz. Feaures altnda Single Symbol fonksiyonunu ayarlaynz. Symbol Selector penceresinden Tabaka DorultusembolnseinizveOKbutonunatklaynz.

115

13. AdvancedbutonundanRotationfonksiyonunuseinizveRotation FieldDorultuolarakayarlaynz.AkolanherikipencerededeOK butonunatklaynz.

14. Builemiletabakadorultusembolleriveritabanndabulunana deerlerinegredndrlmolacaktr. 15. ProjeyikaydedinizveArcMapdenknz.

Uygulama6:CorafiVerilerinSorgulanmas; SelectFeatures,SelectByAttribute,SelectByLocation,Select ByGraphics;


116

Corafi Bilgi Sistemlerinde grafik ve grafik olmayan verilerin birbirleri ile btnleik olarak sorgulanmas mmkndr. Bylece grafik verilerden szel verilere,szelverilerdengrafik(konumsal)verilerehzleriimimkannzolur. nceki uygulamalarmzda Grafik verilerin veritabanna gz atmak istediimizde Tools Toolbardan identify aracn kullanmtk. Benzer ekilde veri taban bilgilerinden Grafik veriye hzl eriimi Main Menu Barda yer alan Find fonksiyonu ile gerekletirmitik. Dier bir deyile Find fonksiyonu text veridengrafikveriyeulamamzsalamt. Bu blmde ArcMap arayznde programn bize grafik semek iin salad aralarn (Select by rectangle, polygon, lasso, circle, line) kullanlmas, Grntlenen Grafik verilerin veri tabanndaki znitelikleri (attributes) zerinden mantksal sorgulamalar yaparak Grafik veriye ulamas (Select By Attributes) ve farkl corafi verilerin birbirleriyle mekansal ilikilerinin sorgulanmas (Select By Location) gibi konular zerinde duracak ve uygulamalaryapacaz. 1. ArcGIS10_Egitim klasrnde yer alan Uygulama_06.mxd dosyasn ArcMaportamndaanz.

2. Trkiye Maden Yataklar Data Frameinde yer alan ILLER katmann Identify aracylainceleyiniz.

117

Find arac sayesinde znitelik bilgilerinden (Attributes) herhangi birini bildiiniz bir grafik veriye ulaabilirsiniz. rnein: orum ilini bulmakistiyorsunuz 3. Veritabanndaki metinsel(text) ifadelerden ekrandaki grafik veriye ulamanz salayan Find arac zerine tklaynz. Features sekmesinde Find kutucuuna orum ifadesini yazp Find butonuna tklaynz. Arama sonular ierisinde orum yazan yere ift tkladnzda ekrandaki grnt otomatik olarak orum zerine gidecekveflashgrntileyerinibelirtecektir.

118

4. SonuzerindemouseunsatuunabaspSelectseeneine bastnzdaiseorumiliseilmiolacaktr.

ArcGIS 10da gelitirilen Tools Toolbardaki Select Features By seenei size farklekillerdegrafikseimimkanlarsunmaktadr. SelectbyRectangle:Oluturduunuzdiktrtgenlegrafikveri semenizisalar. SelectbyPolygon:Oluturduunuzalandikkatealarakgrafikveriyi 119

semenizisalar. SelectbyLasso:Oluturduunuzkementeklinegregrafik veriyisemenizisalar. SelectbyCircle:Oluturduunuzembereklinegregrafik veriyisemenizisalar. SelectbyLine:Oluturduunuzizgieklinegregrafikveriyi semenizisalar.

Bu seenekleri kullanrken seim yapacamz katman Selectable Layer(seilebilir katman) yapmamz daha uygun olacaktr. Sadece bir grafik veri semek iin Select by Rectangle,Lasso veya Circle seeneklerinden birini seip grafik veri zerinde mouse ile tklamanz yeterli olacaktr.Bu aralar size dahahzlseimimkansalamakamacylatasarlanmtr. 5. Katman seilebilirliini ayarlamak iin Table of Contentsde List By Selection sekmesinetklaynz. 6. Listede ILLER katmannda Click to toggle selectable butonuna tklayarakllerkatmannnseilemezolmasnsalaynz.

120

7. KatmantekrarseilebilirolarakayarlamakiinNotSelectable ksmndatekrarClicktotoggleselectablebutonunatklaynz. Bu aamaya kadar ekran zerinde seim aralarn inceledik. imdiki uygulamamzda Trkiye Maden Yataklar Data Framei zerinden baz sorgulamalar yapacaz.Haritadaki iller maden kan noktalarn saysna gre ak renkten koyu renge doru sembolize edilmitir.Amacmz, snrlar ierisinde maden kan noktalarn says belirli olan illerden, belirtilen sayda noktaya sahip olanlar ierisinden metalik maden ierenlerin saysn bulmaktr. Soru: Maden_kan_Nokta says 8den fazla olan illerden, il snrlar ierisindeMetalikMadenbulunduranlarnsayskatr?

8. Main Menu Barda Selection mensnden Select By Attributes seeneiniseiniz.

121

9. Alan pencerede Layer ksmn ILLER katman, Methodu Create a new selection olacak ekilde ayarlaynz. steki pencerede katmana ait field isimleri listelenmektedir. Listeden Maden_Ckan_Nokta seeneine ift tklayarak bu field isminin alttaki komut satrna gelmesinisalaynz. 10. Altpencereye>8yaznz.Komutsatrndakiifadeninekildekigibi olduundaneminolduktansonraOKbutonunatklaynz.

122

Bu ilem ile 8 noktadan fazla noktada madencilik faaliyetleri yrtlen iller eilmiolacaktr.

11. Bu iller ierisindeki Madenleri bulmak iin Selection mensnden SelectbyLocationseeneinetklaynz.

12. Alan pencerede Source layer ILLER, Spatial selection methodu Target Layer(s) features intersect the Source layer feature, Target layer(s) ise MADEN olarak ayarlaynz. OK butonuna tkladktan sonra seili olan ILLER katman ierisine giren btn MADENleri bulacaktr. Metalik Madenleri bulmak iin sorgulamaya devam ediyoruz.

123

13. MainMenuBardaSelectionmensndentekrarSelectByAttributes seeneiniseiniz. 14. Layer ksmn MADEN, Methodu select from current selection olarak ayarlaynz. stteki listeden TUR ismine ift tklayarak aadaki komut satrna gelmesini salaynz. Tr field ierisindeki kaytlar listelemek iin Get Unique Values butonuna tklaynz. Daha sonra listeden Metalik Madenleri seip ift tklaynz. Komut satrna geldiineeminolduktansonraOKbutonunatklaynz.

124

TableOfContentsdeListBySelection sekmesinikontrol ettiimizdeSonuolarakILLERkatmanndan17ilierisinde,MADEN katmanndan99taneseiliMetalikMadenolduunugreceksiniz.

125

15. imdi yeni bir uygulama yapmak zere Ankara Data Frameini aktif halegetirelim.

Soru:AlperSokakn500metkibandndabulunanbinalardantabanalan500 m2denbykolanlarbulunuz. 16. Bu soruyu zmek iin ncelikle Alper Sokakn bulunmas gerekmektedir. Selection mensnden Select By Attributes seeneinetklaynz. 17. Layer ksmn Yol_Orta katman, Methodu: Create a new selection olarak ayarlaynz. AD field zerinde ift tklayarak komut satrna gelmesini saladktan sonra AD field ierisindeki kaytlar grntlemek iin Get Unique Values butonuna tklaynz. Komut Satrnda AD = Alper Sokak yazdna emin olduktan sonra OK butonunatklaynz.

126

18. Alper Sokakn 50 m etki bandndaki binalar bulmak iin Selection MensndenSelectbyLocationseeneinetklaynz. 19. AyarlarekildekigibiyaptktansonraOKbutonunatklaynz.

127

20. Bu aamada Alper Sokakn 50 m etki bandnda kalan btn binalar seilmi olacaktr. Bu binalarn ierisinden taban alan 500 m2den byk olanlar bulabilmek iin tekrar Select By Attributes seeneini tklaynz. 21. SelectByAttributespenceresindeayarlarekildekigibiyapnz.

128

Sonu olarak Yol_Orta katmanndan 1, Binalar katmanndan (Kap_No:37) 1 grafikveriseilmiolacaktr.

129

imdi yapacamz rneklerde ArcGISde Rapor hazrlama ve grafik oluturma fonksiyonlarzerindeduracaz.

RaporOluturma:
BurnekteArcGISinraporhazrlamazelliinernekvereceiz. Ankara Data FrameindeSokakAdlarnveonlaraaituzunluklargsterenbir rapor hazrlayacaz.Rapor hazrlama zellii ArcGISde size rapor hazrlama sihirbaznn salad imkanlarla ok kolay ve ok ksa sre ierisinde gerekletirilebilmektedir. 22. Main Menur Bardan View>Reports>Create Report seeneklerini srasileseiniz

23. Alan pencereden AD ve Shape_Length (uzunluk) Fieldlarn seipsayngsterenokatklaynz.

130

24. Sras ile Next > Next dedikten sonra gelen pencerede Raporda Gstermek istediimiz Fieldlarn adn yani AD ve Shape_Length fieldlarnaadakigibiseiniz.

131

25. TekrarNextbutonunabasarakpencereninsastkesinden raporunyatay(horizontal)veyadikey(Portrait)olmadurumunu ayarlaynz.BurnekiinPortraitseeneiniseiniz.

132

26. TekrarNextbutonunabasnzveHavelockstyleseipNext butonunabasnzveRaporiinbalkbelirleyiniz.Burnekiinbala SokaksimleriveUzunluklaryaznz.

27. Raporu grntlemek iin Finish butonuna tklaynz ve raporu grntleyiniz.

133

GrafikOluturma:
BurnekteArcGISingrafikhazrlamazelliinernekvereceiz. Maden Yataklar Data Frameinde l isimlerini ve o illerdeki maden kan nokta saysn gsteren bir grafik hazrlayacaz. Grafik hazrlama zellii rapor hazrlamada olduu gibi ArcGISde sihirbazn salad imkanlarla ok kolayveokksasreierisindegerekletirilebilmektedir. 28. TrkiyeMadenYAtaklarDataFrameiniaktifhalegetiriniz. 29. View>Graphs>CreateGraphseeneinetklaynz. 30. Alan Graph Wizard penceresinde aadaki ekran kopyasnda olduu gibi Layer/Table ksmna ILLER katmann X Label Fielda AD stn ismini seili hale getiriniz ve Next butonuna tklaynz.

31. PenceredekiTitleksmnaMadenCikanNoktaGrafigiyaznz,Graphin 3D view seeneini iaretliyerek grafii 3 boyutlu grnme kavuturunuz ve Finish butonuna basarak ilemi sonlandrnz.

134

32. Grafiinizekrandaaadakiekildegzkecektir.

33. Uygulama_06.mxdyikaydedipArcMapdenknz.

135

Uygulama7:RasterHaritalarnCorafiOlarak Koordinatlandrlmas(Georeferencing);
Taranm raster verilerin gerek dnya yzeyi zerindeki koordinatlarna tam oturmas iin yaplan ileme corafi koordinatlandrma(georeferencing) denilmektedir. Bu ilemi yaparken raster zerindeki koordinatlar bilinen noktalarn arayzde elemesi salanr. lem sonunda koordinat eleecek noktann seim hassasiyeti, paftann taraycdaki tarama hassasiyetine kadar birok etkene gre RMS(karekk) hatas belirlenir. Bu hata belli bir standard sapma deerinin iinde kabul edilebilir ama bu deerin zerindeyse ilemin tekrargerekmektedir. 1. C:/ArcGIS10_EGITIM/Uygulama07/Uygulama_07.mxdyi ifttklayarakArcMap10daanz. 2. Customize > Toolbars > Georefencing tklaynz. Raster verilerin koordinatlandrlmas iin Georeferencing ara ubuu kullanlmaktadr.

136

3. Table of Contentsde tek bir raster veri bulunduundan dolay Layer seenei otomatik olarak f22d22d3c.tif dosyasn seili olarak getirmitir. Fakat birden fazla raster bulunursa hangi raster zerinde georeferencing ilemi yaplmas isteniyosa ilk olarak Layerdan o rasternseilmesigerekmektedir. 4. GeoreferencingmensnnaltndakiAutoAdjustntikinikaldrnz. 5. f22d22d3c.tif rasternn sol st kesine doru Zoom In aracyla yaknlanz. Raster zerinde bu keye ait koordinatlar yazmaktadr. Georeferencing ara ubuunda bulunan Add Control Points aracn seerek sol ke noktasnda aadaki grntde olduu gibi mouseun sol tuuna bir kere tklaynz. Gerek koordinat deerlerini girebilmekiinmouseunsatuunabirkeretklayarakInput X and Y seeneinitklaynz.AlanpencereyepaftazerindenokuduunuzX veYkoordinatlarnaadakigibiyaznz.

6. lknoktayaaitdeerigirdiktensonraikicikeolarakpaftannsast kesine yaknlanz. Georeferencing ara ubuundaki Add Control Points aracyla sa st keye mouseun sol tuuna bir kere ve

137

ardndan sa tuuna bir kere tklayarak aadaki X ve Y koordinat deerleriniyaznz.OKitklaynz.

7. Aynyntemlerlepaftannsaaltkevesolaltkekoordinat deerleriniaadakigibitanmlaynz.

Sa Alt Ke

Sol Alt Ke

138

8. Tm noktalara ait koordinat deerlerini yazdktan sonra Georeferencing ara ubuundaki View Link Table aracn tklaynz. Alan Link Table penceresinden yanl yazlan X ve Y koordinatlarn Xmap ve Ymap seeneklerinden dzeltebilirsiniz. Daha sonra pencerenin sol altnda bulunan Auto Adjustn tikini atnz.OKitklaynz.

9. Raster veri girilen gerek koordinat deerlerine tand iin ekrandaki grntden kaybolmutur. Full Extent butonuna tklayarak raster ekrana getiriniz. Mouseunuzu hareket ettirdiiniz sa alt ekranda grntlenen koordinat deerlerinin deitiini greceksiniz. Yaplan deiikliklerin farkl bir raster veri olarak kaydedilmesi gerekmektedir. 10. Bunun iin Georeferencing ara ubuunda Georeferencing > Rectify tklaynz. Ayarlar aadaki gibi yaparak Save butonuna basarakilemitamamlaynz.

139

Rektifiye edilen raster veriye projeksiyon sistemi tanmlanmaldr. ArcMap arayz ierisinde saklanabilir pencere olarak gelen ArcCatalog ile verilere projeksiyonsistemitanmlanabilmektedir.

11. Catalog penceresini amak iin Standard ara ubuu zerinde CatalogWindow simgesinitklaynz.

140

12. Catalog penceresinde REC_f22d22d3c.tif dosyas zerinde sa tklayarak Propertiesi seiniz. Alan Raster Dataset Properties penceresinde Spatial Reference seenei herhangi bir projeksiyon sistemi henz tanml olmadndan dolay <Undefined> olarak gelir. YanndakiEditseeneinetklaynz.

13. Alan Spatial Reference Properties penceresinde ayn yere ait daha nceden koordinat sistemi tanmlanan bir katmann koordinat sistemieklemekiinImportuseiniz. C:/ArcGIS10_EGITIM/Uygulama_08/F22d22d3c_Pafta.shpkatmann seerekAddbutonunatklaynz.

141

14. Spatial Reference Properties penceresinde OKi tklaynz. Raster Dataset Properties penceresine koordinat ve projeksiyon sistemleri bilgilerigelmektedir.

142

15. RasterPropertiesekranndaOKitklaynz.REC_f22d22d3c.tifraster corafiolarakkoordinatlandrlmolarakkullanlabilir.ArcMapi kaydetmedenkapatnz.


143

Uygulama8:ArcCatalogdaVeritabanTasarm;
ArcCatalog, ESRInin vektr ve raster verilerinin tasarlanp ynetildii arayz uygulamasdr. ArcGIS Desktop yazlm ierisinde gelen bu arayz ArcGIS 10dan itibaren ArcMap arayz ierisinde ayr bir pencere olarak da gelmektedir.ArcCatalogileunlaryapabilirsiniz; ArcGIS veri formatlarnn oluturulmas (Geodatabase Feature Class, RasterDatasetveShapefile) Veri taban tasarm olarak Fieldlarn oluturulmas ve zelliklerinin belirlenmesi Verilerin kopyalanp yaptrlmas, import, export vb ekilde ynetilmesi VeritabanzellikleriolanSubtypes,Domain,Relationship,Topology, Network Dataset, Geometric Network vb. fonksiyonlarn tanmlanmas ArcMap ve ArcToolbox arayzlerine verilerin srklenip braklmas veynetilmesi VerilereaittanmlaycbilgilerinItemDescriptionolarakbelirlenmesi likisel Veri Taban Ynetim Sistemlerine(IVTYS) dorudan balant kurulmas ArcCatalogarayzndeverilerinPreviewfonksiyonuilenizlenmesi Windows Gezginine benzer ekilde verilerin grntlenmesi, sralanmasveynetilmesi

ArcCatalogdaESRIVektrVerilerininOluturulmas
Shape File; ESRInin ArcView 3x Desktop GIS yazlmndan itibaren rettii grafik ve szel veri depolayan vektr veri formatdr. Shapefile dosyalar Nokta(Point), izgi(Line) ve Alan(Polygon) veri tipleri olarak depolanr. Her katmandabugrafikveritiplerindensadecebirtanesitutulur.Katmanlarveri tabannda .shp, .dbf ve .shx uzantlaryla tutar. *shp; katmana ait grafik 144

verilerinin tutulduu dosya, *dbf; grafik veriye ait znitelik bilgilerinin tutulduu dosya, *shx; grafik veri ile szel veri arasndaki ilikiyi salayan indexdosyasdr. Geodatabase Feature Class; Nokta, izgi ve Alan veri tipleri olarak tanmlanan grafik zellikler, File veya Personal Geodatabase, ArcSDE Geodatabase ierisinde depolanr. Personal Geodatabase Ms Access veri tabannda, ArcSDE Geodatabase ise likisel Veri Taban Ynetim Sistemi(IVTYS) olarak adlandrlan Oracle, Informix, SQL Server, IBM DB2... veri tabanlarnda depolanarak ynetimi salanabilen ESRI vektr veri formatdr. Shapefile formatna gre yeni bir formattr. Nokta, izgi ve Alana aitgrafikverivebunabalznitelikverilericorafiveritabanndatutulur. 1. Balat > Tm Programlar > ArcGISi seiniz. ArcCatalog 10 ayr bir arayz olarak grnmektedir. Fakat bu uygulamamzda ArcMap arayzndeki Catalog penceresinde tm ArcCatalog ilemlerine ait fonksiyonlararatracaz.ArcMap10uanz. 2. Gelenekrandaaadakigibibobirsayfaalmasseeneiniseerek OKitklaynz.

145

Alacak olan Blank Map haritas iin varsaylan bir geodatabase mevcuttur. ArcGIS Desktop kurulduktan sonra Default.gdb corafi veri taban otomatik olarak oluturulmakta ve katmanlarn kayd srasnda varsaylan olarak bu geodatabasekullanlmaktadr. Default.gdbye Catalog penceresindeki st menden ksayol olarak ulalabilir. Bo harita zerinde kullancnn bo bir geodatabase amasna gerek kalmadan kendisi varsaylan olarak bu geodatabase ierisinde katmanlaroluturabilmektedir.

146

3. ArcCatalog penceresini anz. Bir nceki uygulamada rektifiye ettiimizrasterzerindeveritabanoluturmakiin; Folder Connections klasrnn altnda C:/ArcGIS10_EGITIM/Uygulama_07/REC_f22d22d3c.tif dosyasn TableofContentsesrkleyipbraknz.

4. Default.gdb zerinde mouseun sa tuuna tklayarak New > Feature Dataseti tklaynz. Feature Dataset; ayn projeksiyon sisteminde oluturulacak birden fazla feature class iin kullanldr. Name ksmna f22d22 yaznz. Nexti tklaynz. Koordinat sistemi ayarlarn aadaki gibi Import ederek alnz. Dier ekranlarda da Nexti tklaynz.Finishiseiniz.

147

5. Oluturduunuzf22d22featuredatasetiierisindebupaftazerinde saysallatracamz katmanlar oluturmak iin sa tklaynz New > Feature Class seeneine tklaynz. Yeni oluturacamz Imar Cephe izgi katman iin ayarlar aadaki gibi yapnz. Imar Cephe

148

katmannn izgi olmasn istediimiz iin Type seenei Line Feature olarakayarlanmtr.Nextitklaynz.

6. Default.gdb zerinde veri depolama seenekleri Use configuration keyword zelliinden istee gre deitirilebilir. Hibir deiiklik yapmadanNextitklaynz. 7. Grafik veriye ait szel bilgiler iin bu ksmda znitelik field balklar oluturulacaktr. Imar_cephe feature classna veri girii yaplrken hangi zniteliklerin veri tabanna eklenmesi isteniyorsa balklar bu seenekte eklenir. Bu katmana ait field tanmlamasn aadaki gibi yapnz.

149

8. Finishi tklaynz. Catalog penceresinde Default.gdb > f22d22 feature dataset>Imar_Cepheizgifeatureclassnoluturmuolduk.Henz oluturulan Imar_cephe Table of Contents de dorudan eklenmi olarakgelmektedir.

150

9. f22d22 feature dataset zerinde tekrar sa tklayarak New > Feature Class seiniz. Ayn ilemler Imar_Alan katman iin de yaplacaktr. Ayarlamalar aadaki gibi yaparak Imar_Alan alan katmann oluturunuz.

10. Direkler(Point) ve Binalar(Polygon) katmanlarn aadaki ekillerde oluturunuz. 151

Direkler katman iin

Binalar katman iin 11. En son oluturulan katmann znitelik field balklarndan SHAPEi yanndaki gri kk kutucua tklayarak seiniz. Seili olan Field Namee ait zellikler pencerenin altnda grntlenecektir. Shape field oluturan geometri zellikleri Field Properties ksmnda grntlenmektedir.

Bu ilemler ile veri taban tasarm gerekletirilmitir.Bu aamadan sonrapaftasaysallatrlacaktr. 152

Uygulama9:VeriGiriiveGncelleme
Oluturulan veri tabanna veri girii yapma ilemine saysallatrma denilmektedir. Saysallatrma ilemi ESRI vektr veri tipleri olan Shapfile ve Geodatabase Feature Classlara ait gerekli gncellemelerin yaplarak veri tabannaszelbilgilerinindeeklenmesiniiermektedir. ArcGIS 10 versionundan itibaren gncelleme ilemi iin kullanlacak Editing aralar glendirilerek gelitirilmitir. Artk CAD kabiliyetinde izimler ok daharahatbirekildeyaplmaktadr. 1. Bir nceki uygulamada Default.gdb ierisine oluturduunuz katmanlar ve Rektifiye ettiimiz altlk raster verinin(REC_f22d22d3c.tif) halen ArcMapte bulunduundan emin olunuz. 2. Standard ara ubuunda bulunan Editor ara ubuunu amay salayan Editor Toolbar aracn tklaynz. Vektr veriler zerinde gncelleme yapmamza olanak salayan Editor ara ubuu ekrana gelecektir. 3. Katmanlar zerinde veri girii yaplmas ilemini balatmak iin Editor > Start Editingi tklaynz. Ekrana Create Features penceresi gelecektir. Bu pencere ile veri girii yaplacak katman seerek ekran zerindensaysallatrmayaplmaktadr.

153

4. Create Features penceresindeki Imar_Alan polygon katmann seiniz. Imar_Alan katman seildikten sonra aada Construction ToolsseeneindePolygonuseiniz.

154

5. Data View ekrannda pafta zerinde imar alan olarak saysallatrlacak kenar ksmlara mouse ile tklanarak izim yaplr. Feature olutururken tklanlan her noktaya yeil renkli atlan noktalara Vertex ad verilmektedir. Vertexler ile izimi istenilen ekilde deitirebilirsiniz. Bunun iin izim srasnda Feature Construction ara ubuu ekrana gelmektedir. izimi sonlandrmak iinklavyenizdenF2tuunabasnz.

155

6. BenzerekildeImarAlaniziminedevamediniz.

7. izimi yaparken Editor ara ubuu zerinde bulunan Attributes aracn tklaynz. Alan Attributes penceresi saklanabilir olarak ekrana gelmektedir. znitelik deerleri ekranda seili olan feature iin doldurulur. mar alan olan yerleri saysallatrmay ve znitelik bilgilerinidoldurmaysrdrnz.

8. Create Feature saklanabilir penceresini arnz. Binalar katman seiniz ve pafta zerindeki binalar saysallatrarak veri girii yapmayabalaynz.

156

9. Pafta zerinde bina saysallatrmaya balaynz. izim yaparken alan Feature Construction penceresindeki yardmc izim elemanlar kullanlacaktr. Aadaki gibi binaya yaknlanz ve izim yapmaya balaynz, Constrain Perpendicular aracn seerek dik izmek istediiniz izgiyi seiniz. Ayn izgiye devamnda paralel izmekiinConstrainParallelaracnseerekiziniz.

157

izimi bu aralarla srdrnz ve F2ye basarak(yada mousea ift tklayarak) izimisonlandrnz.

10. Create Feature saklanabilir penceresini tekrar arnz. Imar_Cephe katman seiniz. Construction Tools seeneinde izgi feature izimi yapmaysalayanaralarngeldiigrlmektedir.Lineseiniz. 158

Paftazerindesaysallatrmakistediinizimarcephesineyaknlanzveizim yaparak znitelikleri doldurunuz. izimi tamamladktan vertexleri grntlemek ve izimde deiiklik yapmak iin ift tklayabilirsiniz. Vertexler grntlenirken Edit Vertices ara ubuu ekrana gelir. Vertex zerindeki deiikleriburadanyapabilirsiniz.

159

11. Yaplan gncelleme ilemlerini kaydetmek iin Editor araubuunda Editor > Save Editing seeneini tklaynz. Gncelleme ilemini sonlandrmak iin Editor > Stop Editing aracna tklaynz. Bylece veri tabann oluturduumuz katmanlara veri girii yaplmtr. Daha sonra bu verilere ekleme ya da dzenleme yaplmak istenildiinde Start Editing seeneini seerek ara ubuunu aktif hale getirmemiz gerekmektedir.

12. ArcMapte allan projeye daha sonra ayn semboloji ile devam etmekisteniliyorsaMXDolarakkaydedilmesigerekir. File > Save As seiniz. Projeyi C:/ArcGIS10_EGITIM/Uygulama_09 klasr ierisine F22D22.mxd olarak kaydediniz ve ArcMapi kapatnz.


160

Uygulama10:VeriGncellemeveSaysallatrmaKabiliyetleri;
Bu uygulamada, veri gncelleme ilemi srasnda saysallatrma ilemini salayanbazileridzeyaralargsterilecektir. 1. Balat > Tm Programlar > ArcGIS > ArcMap 10 seerek C:/ArcGIS10_EGITIM/Uygulama_10 klasrnde bulunan Uygulama_10.mxddosyasnanz. 2. Editor ara ubuunu arnz ve Editor > Start Editingi seiniz. Binalar katmanndaki izilmi baz featurelar olmas gereken koordinatlaratamakiinEditoraraubuuzerindekiEditTool aracn seerek feature zerinde tklaynz. Mavi renkte seili hale gelen feature mouse ile tutup harita zerindeki koordinatlarnataynz.

161

3. Farkl ynde dndrlm featurelarn Rotate aracn kullanarakdoruayalmasnsalaynz.

4. Create Features saklanabilir penceresinden Binalar katmann seereksaysallamamikiadetbinayekranzerindenmouseile tklayarak saysallatrnz. Saysallatrma ilemini yaparken Constrain Parallel ve Constrain Perpendicular aralarn kullanarakizimyapnzveF2yebasarakizimisonlandrnz.

162

izdiimiz binalarn bulunduu yere ait parselin araziden alnan koordinat ve lm deerleri bulunmaktadr. Bu deerler ile Parselsaysallatrmayaplacaktr. 5. CreateFeaturespenceresindeParsellerkatmannseinizveData View ekrannda mouse ile sa tklayarak Absolute X,Y seeneine tklaynz (Klavye ksayolu F6dr). lk noktann X ve Y koordinatlarnaadakigibiyaznz.Enterabasnz.

163

6. Harita zerinde girilen koordinatlara vertex atlm olarak gelmektedir. Buvertexegreavemesafedeerigirilerek izim yaplacaktr.BununiinmouseilesatklayarakDirection/Lenght seeneine tklaynz (Klavye ksayolu Ctrl+Gdir). Aadaki deerleriyazarakEnterabasnz.

7. Parsele ait nc noktaya ait koordinat deeri bilinmektedir. Klavyeden F6ya basarak aadaki deerleri yaznz ve Entera basnz.

8. Parseleaitdrdncnoktabellibir eimleizilecektir.Bununiin mouse ile sa tklayarak Tangent Curve seeneine tklaynz ve aadakideerleriayarlaynz.Enterabasnz.

9. Drdnc noktaya gre belli bir a ve mesafe deerine gre beinci son nokta belirlenecektir. Klavyeden Ctrl+Gyi tklayarak aadakideerlerigiriniz.Enterabasnz. 164

10. izimibitirmekiinF2yebasnz. 11. Parsel iziminde deiiklik yapmak iin Vertexler zerinde deiiklikler yaplr. Deiiklik yapmak iin katman zerinde sa tklayarak Edit Vertices seip Sketch Properties penceresini aabilirsiniz.

12. Oluturduumuzparselkatmannnznitelikbilgilerinidoldurmak iinAttributesTableanzveParselReffieldna1yaznz.

165

13. izerek oluturduumuz parselin zerinde bulunan 9 adet binay Edit Tool ile seiniz. Seili olan tm binalar ayn parsel referans deerine sahip olduklarndan dolay ParselRef znitelik deeri ayn olacaktr. znitelik tablosunda ayn deeri toplu ekilde yazdrmak iin Binalar katman zerinde sa tklayarak Open Attributes Table seiniz. Alan Table penceresinde sadece seili olanlar gstermek iin pencerenin en altnda bulunanShowSelectedRecordsseeneiniseiniz.

166

14. Binalar znitelik tablosunda ParselRef Fieldn bulunuz ve balk zerinde sa tklayarak Field Calculatoru seiniz. Sadece seili olan objeler iin ilem yapacak olan Field Calculator penceresinde1yaznzveOKitklaynz.

Editing ilemi srasnda grnty oynattmz zaman altlk olarak kullanlan raster veya dier katmanlarn tekrar ekranda alma hz veri boyutuna gre yava olarak gelebilmektedir. Bu ilemi hzlandrmak iin ArcGIS 10 verisonundanitibarenBasemapLayerlaroluturulabilmektedir. 167

15. Layers veri erevesi zerinde sa tklayarak New Basemap Layer seiniz. Table of Contentse gelen New Basemap Layera Ankara.imgaltlkrasterveriyisrkleyipbraknz.

16. Yol_Orta izgi katmann anz. Grntlenebilirlii aktif olarak gelen katman Create Features penceresinde de grntlenebilir olarak gelmektedir. Yol_orta katmann izgi izimeklini seecek ekilde tklaynz. Aadaki gibi yol katman izilecek olan ksma yaknlanz. Kesiim noktasna yaknlatnz zaman otomatik yakalama(snap) yapmaktadr. Kesiim noktasn tklaynz ve yolu aadaki gibi iziniz. Grntnn ekrana smad yerde ilerletme yaparken altlk raster veri Basemap olarak ayarladndan dolay hzl bir ekilde ekrana gelmektedir. Snapping ilemlerini zelletirmek iin Customize > Toolbars > Snappingaraubuunuarabilirsiniz.

168

17. Gncelleme ilemi tamamlandktan sonra Editor ara ubuu zerindeEditor > Save EditsiveardndanEditor > Stop Editingi seiniz.ProjeyikaydederekArcMapikapatnz.

169

Uygulama11:Diergncellemearalar;
Corafi Bilgi Sistemlerinin paras olarak gncelleme ileminde yaplacak ilemleri kolaylatracak farkl fonksiyonlar mevcuttur. Editing aralar olarak adlandrlan bu fonksiyonlar ile vektr veri oluturmada kolaylklar salanmaktadr. 1. Balat > Tm Programlar > ArcGIS > ArcMap 10u anz. Uygulama verisetleri iinde bulunan C:/ArcGIS10_EGITIM /Uygulama_11 /Uygulama_11.mxdyi anz. Alan haritada Parsel, Refuj, Elektrik Direkleri, Elektrik Hatt katmanlar Table of Contents mensne gelecektir. 2. Editor ara ubuu bir nceki uygulamada arayze eklendii iin ekrana gelmitir. Eer gelmediyse Editor ara ubuunu tklayarak arnz. Editor > Start Editingi seerek gncelleme ilemleriiinEditingaraubuklarnaktifhalegetiriniz.AlanCreate Features penceresinin sa st kesindeki Auto Hide aracn tklayarakpencereyisaklaynz.

3. Refujlerin oluturduu yolun ortasndan elektrik hatt gemektedir. Refuje paralel olacakekilde Elektrik Hatt feature kopyalamak iin nce Refuj katmanndaki hangi featurea paralel oluturmak isteniyorsa, onu Edit Tool aracyla seiniz. Editor ara ubuunda Editor > Copy Parallel seeneini seiniz. Alan Copy Parallel penceresinde aadaki ayarlamalar yapnz. OKi tklaynz. Bu ayarlar ile seili refuj featurenn 4m ok ynne gre sa tarafna elektrikhattfeaturekopyalanacaktr. 170

4. Oluturulan elektrik hatt featuren Edit Tool aracyla seiniz. Elektrik hatt zerine 10 metre aralklarla elektrik direkleri yerletirilecektir. Bunun iin Editor > Construct Points seeneini seinizveaadakiekildeayarlamalaryaparakOKitklaynz.

171

5. Birden fazla feature birletirerek tek bir feature haline getirmek iin Merge arac kullanlmaktadr. Aadaki gibi birden fazla parseli Edit 172

Tool ile seiniz. Editor ara ubuunda Editor > Merge fonksiyonunu seiniz. Alan pencerede birletirme sonucunda hangi featuren znitelik tablosundaki bilgiler alnmas istenildiini seerek OKitklaynz.

6. Create Feature penceresinden Refuj izgi katmann seiniz. Editor ara ubuunda bulunan Trace aracn seiniz ve parsellerin sol tarafnda mouse ile tklayarak refujun alaca gzergahta sadece mouseu hareket ettiriniz ve bittii tarafn darsnda mouse ile ift tklayarakizimisonlandrnz.

173

7. izilen Refuj etrafndaki parselleri belli bir mesafede kesmek iin Clip fonksiyonu kullanlmaktadr. Editor ara ubuunda Clip aracn seinizveaadakideerleriyazarakOKitklaynz.

8. Editor ara ubuundan Save Edits ve Stop Editing ile kaydederek gncellemeyi sonlandrnz. Projeyi ayrca mxd olarak kaydederek ArcMapikapatnz.

174

Uygulama12:VeriDnmFonksiyonlar;
DWG,DXF ve DGN gibi ok kullanlan CAD formatlar ArcGIS teknolojisi rnleri ArcView,ArcEditor ve ArcInfo yazlmlar ile direk olarak grntlenebilmektedir. CAD veri formatnda depolanan vektr veri yapsn farkl yntemler kullanarak ArcGIS vektr veri formatlarna evirmek mmkndr.CAD formatlarnn, ESRI Shape file ve Feature Class dnm ilemleri ArcMap ve ArcToolBox arayzlerinde bulunan fonksiyonlar sayesinde daha pratik ve esnekbirekildeyaplabilmektedir. zellik tipleri Line,Point,Polygon ve Annotation olan bir izim dosyasnda depolanan CAD veri formatlarnn, corafi detaylar ise CAD formatlarnda (DWG ve DGN) Layer ve/veya Levellarda snflandrlarak saysallatrma ilemleri gerekletirilir.CAD verileri ArcGIS teknolojisinde aadaki ekilde temsiledilmektedir.

175

1. ArcMap10arayznanz. 2. ArcGIS10_Egitim/Uygulama_12 dosyasnda yer alan Uygulama_12.mxdyi anz. (Bu uygulama iin 1022.dgn verisinin Polyline, Polygon ve Point katmanlar Add Data butonu ile ArcMap ortamnaeklenipmxdolarakkaydedilmitir.) 3. Table of Contentsde bulunan 1022.dgn Point ve 1022.dgn Polyline katmanlarnn visible ekini kaldrarak grnmez hale getiriniz.1022.dgn Polygon zerinde mouse ile sa tklayp Katman zellikleri(properties)penceresiniseiniz.

176

4. Alan pencerede Drawing Layers sekmesinde,tm katman zellikleriniDisableAllbutonunabasarakkapatnz.

5. Daha sonra Layer 25 katmannn ekini atarak Enable durumuna getiriniz. OK butonuna tkladnzda Polygon zellik tipini tayan Layer25katmanndaizilenbinalarharitasayfasndagrecesiniz.

177

6. Table of Contentsde yer alan 1022.dgn Polygon katman zerinde mouseun sa tuuna basnz. Data > Export Data fonksiyonunu seiniz.

178

Export Data ilemi ile 1022.dgn Polygon katmannda bulunan tm objeleri katmann sahip olduu koordinat sistemini koruyarak ShapefileveyaFeatureClassaevirmekmmkndr. 7. Browse aracna tklayarak bilgisayarnzda dosyann kaydedilmesiniistediinizyeribelirleyiniz.

Oluturulmas dnlen bina katman byk lekli harita uygulamalarnda alansal vektr (Feature Type:Polygon) tipine sahip olmaldr.CAD ortamnda izilen objeler iin ise yukarda anlatlan ilemler sonucunda alansal vektr tipi elde edilebilir.CAD ortamndaki alan ifade etmesi istenen objeler Close Polygon olarak izilir.Corafi Bilgi Sistemleri ierisinde alan olarak tanmlanmas istenilen CAD verileri ou zaman polygon olarak tanmlanamaz.Bu veriler CAD ortamnda genelde Polyline olarak retilir.Bu verilerin Polyline olarak tasarlanm yapsn Export ilemi ile Line vektrel tipine evrilir.Bu ilem sonucunda verilerde izim hatas var ise hatalar dzeltmek ve izgi zelliini daha sonra alan zelliine dntrmek gerekecektir.Bublmdednmilemleriuygulamalolarakilenecektir. 179

8. TableofContentsdeyeralanvedahancevisibleekinikaldrdmz 1022.dgn Point ve 1022.dgn Polygon katmanlarnn eklerini tekrar aktif hale getiriniz.1022.dgn Polyline katman zerinde mouse ile sa tuatklaypPropertiesseeneiniseiniz.

9. Layer properties penceresindeki Drawing Layers sekmesini seiniz.Tm katman zelliklerini Disable All butonuna tklayarak kapatnz.Daha sonra Layer 61 katmannn ekini atarak Enable durumagetiriniz.

180

10. Table of Contentsde bulunan 1022.dgn Polyline katman zerinde mouseun sa tuuna tklayarak Data>Export Data fonksiyonunu seiniz. 11. Export Data fonksiyonu ile 1022.dgn Polyline katmannda bulunan tm objeleri,mevcut projeksiyon sistemine gre Shape File veya Feature Class olarak olarak dntrmek mmkn olacaktr.Export DatapenceresindekiBrowse aracnatklaynz.

181

12. 61inciLayerdayeralanPolylineobjelerini,Uygulama_11dosyas altnaBinalarLineShapefileolarakkaydediniz. Bu aamada izgi zelliinde gelen yeni BinalarLine katmann poligona evirmemiz gerekmektedir. Bu ilem iin ArcToolBoxdaki Feature To Polygon fonksiyonu kullanlacaktr. ArcGIS 10dan itibaren ArcToolboxdaki fonksiyonlar Search penceresinden kolaylklaaratlabilmektedir. 13. StandardaraubuundakiSearch aracnatklayarakSearch penceresinianz. 14. AlanSearchpenceresindeToolseeneiniseiniz.

15. AramakutucuunaFeatureToPolygonyazpEnteratklaynz.

182

16. Listeden Feature To Polygon fonksiyonuna tklayp Feature To Polygonpenceresininalmasnsalaynz. 17. Ayarlar ekildeki gibi yaptktan sonra OK butonuna tklaynz. izgi katmanndakibinalarnznalankatmannadntngreceksiniz.

18. 1022.dgn Point katmannda yer alan noktasal verilerin birbirinden ayrtedici zellii Text Fieldnda yer alan znitelik deerleridir. Text Field AGAC olarak tanml olan objeleri Select By Attributes fonksiyonuileseiniz.

183

19. SeiliolanobjeleriaakatmanolarakexportetmekiinTableof ContentsdePointzerindesatklayarakExport>ExportData seeneinetklaynz.DahasonraAgacadaltndaveriyiShapefile olarakkaydediniz. 20. ArcMapikapatnz.

NoktasallmDeerlerininGrntlenmesi;
GPS,TotalStation gibi lm cihazlar ile elde edilen koordinat bilgileri,saysal olarak sistemde Dbase, Excel, ASCII Text File gibi farkl formatlarda depolanabilirler. ArcGIS ortamnda, bu formatlardaki verilerin ESRI vektr formatlarnadnmmmkndr. Bu blmdeki uygulamada X,Y koordinat deerlerinin bulunduu Dbase ve Excel dosyalarnn, ESRI Shape File formatna dnm ilemleri ArcMap arayzndegerekletirilecektir. 184

AddXYDataFonksiyonu;
Dbase formatnda yer alan koordinat bilgilerinden, Shapefile formatnda dnm ilemleri ArcMap arayznde Add XY Data Fonksiyonu ile gerekletirilmektedir. 1. ArcMap10arayzndebobirharitasayfasanz. 2. File>AddData>AddXYDataseeneinetklaynz.

3. Alan pencerede Choose a table from the map or browse for another tableksmndakiBrowse aracnatklayp Uygulama_12 dosyas ierisindeki Parsel_Kose_Dbase.dbf dosyasn seiniz ve Add butonunatklaynz.

185

4. Add XY Data penceresinde X Field ve Y Fieldda aadaki stn isimleriniseipOKbutonunatklaynz.

5. YaptnzbuilemsonucundaParsel_Kose_Dbase.dbfdosyasndayer alan X ve Y koordinat deerleri temsilen ArcMap harita sayfasnda Parsel_Kose_Dbase_Eventsformatndagrntlenecektir.

186

6. Bu dosyalar Export Data yntemi ile Shapefile veya Feature Class olarak kaydedilebilmektedir. Bunun iin Parsel_Kose_Dbase_Events katman zerinde mouseun sa tuuna tklayarak Data>Export Data fonksiyonunu seiniz ve Uygulama_12 dosyasnn iine,Parsel_Dbase ShapeFileolarakkaydediniz.

7. ArcMaptenknz.

187

Uygulama13:ZamanBilgisiileanimasyonoluturma;
ArcGIS 10 vektr ve raster verilerde zaman bilgisini desteklemektedir. Bu uygulamada, vektr veriler zerinde Osmanl Devletinin Ykselme, Duraklama ve Gerileme Devirlerindeki toprak byklkleri animasyon haline getirilecektir. 1. ArcGIS10_EGITIM/Uygulama_13klasrnde Uygulama_13.mxdyiArcMapteanz. yer alan

TableofContentsdeOsmanl,Ulkeler vektrelkatmanlarnnveESRITerrain Basemapininolduunugreceksiniz. 2. Osmanli katmannda sa tklaynz ve Open Attribute Table seeneinetklaynz.

znitelik tablosunda, yil field fetih yllarn gstermektedir. tarih field ise animasyondakullanlmakzerealmtr. 3. zniteliktablosunukapatnz. 4. Osmanli katmannn kutusunun ekini atarak katmann grntlenmesinisalaynz. 188

5. Osmanli katmannda tekrar sa tklayarak Properties seeneine tklaynz.

6. 7. 8.

9. 10.

LayerPropertiespenceresindeTimesekmesinetklaynz. TimesekmesindeEnabletimeonthislayerkutusununekiniatnz. Layer Time ksmndan Each feature has a single field seeneini seiniz. Timefieldksmndantarihfieldnseiniz. TimeStepIntervalksmnekildeolduugibi1Dayolarakayarlaynz veOKbutonunatklayarakkatmanzellikleripenceresinikapatnz.

189

11. ToolsToolbardakiOpenTimeSliderWindow aracnatklaynz. 12. TimeSliderpenceresindekiEnableTimeonMapbutonunatklaynz. 13. Time Slider Window penceresinden Play butonuna tklaynz ve animasyonubalatnz.

190

14. Daha sonra bu animasyonu .avi formatnda video olarak kaydetmek iinExporttoVideoaracnatklaynz.

15. Export Animation penceresinden videoyu kaydedeceiniz yeri seiniz veisimveriniz. 16. Exportbutonunatklaynz.

191

17. AlanVideoCompressionpenceresindeOKbutonunatklaynz.

Bu aamada videonuz bilgisayarnza kaydedilecektir. Ekrann altnda videonun %100 oluturulana kadar bekleyiniz. Daha sonra videoyu izleyebilirsiniz. 192

Uygulama14:ArcMapteMapPackageoluturulmas;
Bu uygulamada, arcgis.coma ye olarak haritalarn web zerinden paylam gsterilecektir. Bunun iin tm kullanclar arcgis.com adresinde kendileri iin birer hesap oluturacak daha sonra slem grubuna ye olacaklardr. Bu aamadan sonra hazrladklar tm harita ve katmanlar internet zerinden kolaylklapaylaabileceklerdir. 1. ArcGIS10_EGITIM klasrnde yer alan Uygulama_14.mxdyi ArcMapteanz. 2. Haritannsembolojisinidilediinizgibiayarlaynz. 3. FilemensnnaltndanCreateMapPackageseeneinetklaynz.

4. Alan pencerede Save package to file seeneini setikten sonra Browse aracnatklaynz.

193

5.

6. 7. 8.

Harita paketini C:\ ArcGIS10_EGITIM\Uygulama_14 dosyasnn ierisineisimvererekkaydediniz. Validatebutonunatklaynz. DahasonraSharebutonunatklaynz. AlanpenceredeYesbutonunabasnz.

9. Harita paketinizin baarl bir ekilde oluturulduunu gsteren mesajkutusundaOKbutonunatklaynz.

194

ArcGIS.comayelik;
10. KullandnzWebBrowserdaadresubuunawww.arcgis.com yaznz.

11. www.arcgis.com sayfas aldktan sonra sa st kedeki Sign In butonunatklaynz. 12. Alan sayfada sa taraftaki Dont have an ESRI Global Account? BalaltndakiCreateanaccountseeneinetklaynz.

195

13. Alan sayfada ye olmanz iin gerekli olan bilgileri doldurmanz gerekmektedir. Bilgileri eksiksiz olarak doldurduktan sonra Create MyESRIGlobalAccountbutonunabasnz.

islemegitim

14. Aadakisayfaaldktansonrakaytyaparkenveriinizmail hesabnzanz.ESRIningndermiolduumaildekilinketklayarak hesabnzaktifhalegetiriniz.

15. LinketkladktansonraalansayfadaifreyigirinizveFinish butonunabasarakkaytileminisonlandrnz.

196

16. Dahasonraalanekrandaoluturmuolduunuzhesapbilgilerini girinizveRegisterbutonunatklaynz.

17. ArcGIS.comkullanmkoullarnkabuletmekiinalanpenceredeI Acceptbutonunabasnz.

197

Dilerseniz kullanc hesabnzdaki bilgileri doldurabilir ve resminizi ekleyebilirsiniz. ArcGIS.comdaslemGrubunayelik; Bu eitim sonucunda, tm katlmclarn ArcGIS.comda bulunan slem Grubuna ye olmalar ve ilerde dilerlerse haritalarn grup zerinden paylamalar amalanmaktadr. Bu nedenle, bu uygulamada katlmclarn grubanaslyeolacaklaranlatlacaktr. 18. YukardakiaraubuundanGroupsseeneinetklaynz. 19. SearchForksmnaslemyazpEnterabasnz.

198

20. AlanlistedenslemGrubunuseiniz. 21. DahasonragrubakatlmakiinJoinThisGroupbutonunatklaynz. 22. EkrandaalanpenceredeSubmitRequestseeneinetklaynz.

BuaamadansonraslemGrupYneticisiyeliklerinizikabuledecektir. OluturulanHaritaPaketininwebeeklenmesi; 23. YukardakiaraubuundanMyContentseeneinetklaynz. 24. AlansayfadaharitanzwebeeklemekiinAddItembutonuna tklaynz. 199

25. DahasonraalanpenceredeDosyaSebutonunatklayarak uygulamannbandakaydettiinizharitapaketiniseiniz.

26. Tagsksmna,haritanzbirbakasaratrkeniineyarayacakolan anahtarkelimeleriyaznzveAddItembutonunabasnz. 27. SayfanzaeklemiolduunuzharitanzslemGrubuyeleriyle paylamakiinSharebutonunatklaynz. 28. SharepenceresindeislemkutusununekiniatnzveOKbutonuna tklaynz.

200

Bylece kendi oluturduunuz haritanz web zerinden dier grup yeleriyle paylam oldunuz. Artk dier grup yelerinin ekledikleri haritalar inceleyebilirsiniz.


201

Uygulama15:GrntAnalizi
ArcGIS 10 da yeni bir pencere olan Image Analysis penceresi kullanclara ; grnt ve raster verilerin analiz edilmesi ve ilenmesi konusunda zel aralar sunmaktadr. Image Analysis penceresi temel olarak drt blmden olumaktadr. Seenekler : Grnt ilemleme ile ilgili zelayarlarnyapldblmdr.

Katman Listesi : Aktif olan alma alanndakimozaikverisetleri,imajservisler ve WCS katmanlar dahil tm raster veriler buradalistelenir. GrntAyarlar:Verileringrnmile ilgilideiikliklerinyapldblmdr.Bu blmderasterverilere,kontrastlk, parlaklk,transparanlk tanmlanabilmekte,gammayntemi uygulanabilmektevedinamikaralk ayarlamas(DRA)yaplabilmektedir.ki raterverininkarlatrlmasnsalayan ikizelaradaiermektedir. RasterVerilerinlenmesi:Bublmde kullanclaryaygnolarakkullanlan;.raster kesme,maskeleme,ortorektifikasyon, mozaiklemegibirasterilemetekniklerini birerbutonilekolaylkla gerekletirebilmektedirler.

202

BuuygulamadaKanadayaaitbirLandsatuydugrntszerindekesme ilemi gerekletirilecektir. 1. ArcGIS10_EGITIM/Uygulama_15klasrndeyeralan Uygulama_15.mxdyiArcMapteanz. TableofContentsdecan_tmr.imguydugrntsvealanshapefilekatman grntlenmektedir.

2. WindowsMensndenImageAnalysisWindowseeneine tklayarakImageAnalysispenceresinianz.

203

3. EditorMensndenStartEditingseeneiniseerekgncellemeyi balatnz. 4. EditToolilealankatmanndaizilmiolandetayzerindeift tklayarakkenoktalarnnalmasnsalaynz. 5. Daha sonra sa alt taraftaki iki ke noktasn seerek kesilecek olan alanbirazdaraltnz.

ArcGIS10danitibarenkenoktalarokluolarakseilebilmektedir.

204

6. KesmekistediinizalanseiliikenImageAnalysispenceresindeki can_tmr.imgkatmannseiniz.BuilemsonucundaProcessing blmndekibazfonksiyonlarnaktifhalegeldiinigreceksiniz. 7. ProcessingblmndekiClipbutonunatklaynz. ImageAnalysispenceresindeveTableofContentsmensnde Clip_cam_tmr.imgadndageicibirkatmanoluacaktr.Tableof Contentsdekidierkatmanlarneklerinikaldrarakkesilenalan grntleyiniz.

8. KesilenalankaydetmekiinProcessingblmndekiExport seeneinetklayarakekildegrlenayarlaryaparakbilgisayarnza kaydediniz.

205

9. ArcMapikapatnz.

206


207

Kaynaklar
208 Kp,S.,2004ArcGIS9UygulamaDokman.Ankara ESRIArcGIS10Help ESRIArcGISDesktopResourceCenter http://resources.arcgis.com/content/arcgisdesktop/10.0/

209