You are on page 1of 4

1.

1. In the experiment below, steam is passed through heated magnesium powder.


Dalameksperimen di bawah, wap air dilalukanmelaluiserbuk magnesium yang dipanaskan.

(a) Name the gas Q formed in the reaction.


Namakan gas Q yang terbentukdalamtindakbalas.

[1 mark/markah]

(b) Suggest a chemical test to confirm your answer to (a) above.


Cadangkansatuujiankimiauntukmengesahkanjawapananda di (a) di atas.

[1 mark/markah]

(c) Write a word equation for the reaction above.


Tuliskansatupersamaandalamperkataanuntuktindakbalas di atas.

[1 mark/markah]

(d) State the reactant that is


Nyatakanbahantindakbalas yang
(i) oxidized
dioksidakan

(ii) reduced
diturunkan

[2 marks/markah]

(e) If the experiment is repeated by replacing magnesium powder with copper powder, will
there be any reaction? Explain your answer.
Jikaeksperimendiulangdenganmenggantikanserbuk magnesium denganserbukkuprum,
adakahterdapatsebarangtindakbalas? Terangkanjawapananda.

[2 marks/markah]

2. The diagram below shows the carbon cycle.


Rajah di bawahmenunjukkankitarkarbon.

(a) State the process labelled Y.


Nyatakan proses berlabel Y.

[1 mark/markah]

(b) What is the process of taking out carbon dioxide from the atmosphere?
Apakah proses pengambilankarbondioksidadaripadaatmosfera?
[1 mark/markah]

(c) How does carbon return to the soil?


Bagaimanakahkarbonkembalisemulaketanah?

[1 mark/markah]

State another activity done by a human that increases the content of carbon in the
air.
Nyatakanaktiviti yang telahdilakukanolehmanusia yang
meningkatkankandungankarbondalamudara.

[1 mark/markah]

What will happen to the temperature on Earth if the activity in (d) (i) is carried out
in an uncontrolled way?
Apakah yang berlakukepadasuhuBumijikaaktivitidalam(d) (i)
dijalankantanpakawalan?

[1 mark/markah]

What is the effect to Earth resulting from (d) (ii)?


ApakahkesanterhadapBumidisebabkandaripada(d) (ii)?

[1 mark/markah]
[1 markah]
3.. The diagram shows the cross section structure of the oil palm fruit.
Rajah menunjukkankeratanrentasstrukturbuahkelapasawit.

(a) Which part of the oil palm fruit produces the most oil?
Bahagianbuahkelapasawit yang manakahmenghasilkan paling banyakminyak?

[1 mark/markah]

(b) Name the process to produce palm oil from the fruit.
Namakan proses untukmenghasilkanminyakkelapasawitdaripadabuahnya.

[1 mark/markah]

(c) State two purposes of sterilization in the process of producing palm oil from the fruit.
Nyatakanduatujuanpensterilan di dalam proses
penghasilanminyakkelapasawitdaripadabuahnya.

[2 marks/markah]

(d) Name one vitamin that can be extracted from palm oil.
Namakansatuvitamin yang bolehdiekstrakdaripadaminyakkelapasawit.

[1 mark/1 markah]

(e) Suggest one potential industry that can be carried out with the residue of oil palm.
Cadangkansatuindustri yang berpotensi yang bolehdilakukandengansisakelapasawit.

[1 mark/markah]

You might also like