CHAPTER 1 OVERVIEW OF PROJECT 1.

1 ABOUT THE PROJECT

V3 mailserver is an easy way of transferring mails.The working of the project is as follows. In the Login link a user have to login for transferring mails. Next page provides several links. The Home page contains several links such as my settings, Inbox, Compose, Trash, My folder, Sent Items, Address Book and Logout. An already registered user can simply type in -his\her valid username and password, and then click the "submit" button. But those visitors who are not registered have to go to the registration page before they login. In that page user have to enter First name, Last name, Address, Postal Code, City, Phone number, Username and password. After registration user can sign in and check or send mail .User can add new contacts and signature. Logout link will help the user to logout from the site.

CHAPTER 2 TOOLS 2.1.J2EE SERVER Java Platform, Enterprise Edition or Java EE (formerly known as Java 2 Platform, Enterprise Edition or J2EE until the name was changed to Java EE in version 1.5), is a programming platformpart of the Java Platformfor developing and running distributed multitier architecture Java applications, based largely on modular software components running on an application server. The Java EE platform is defined by a specification. Similar to other Java Community Process specifications, Java EE is also considered informally to be a standard because providers must agree to certain conformance requirements in order to declare their products as Java EE compliant; albeit with no ISO or ECMA standard. Java EE includes several API specifications, such as JDBC, RMI, e-mail, JMS, web services, XML, etc, and defines how to coordinate them. Java EE also features some specifications unique to Java EE for components. These include Enterprise JavaBeans,servlets,portlets(following the Java Portlet specification), JavaServer Pages and several web service technologies. This allows the developer to create an enterprise application that is portable between platforms and scalable, while integrating with legacy technologies. Other added bonuses are, for example, that the application server can handle the transactions, security, scalability, concurrency and management of the components that are deployed to it, meaning that the developers can concentrate more on the business logic of the components rather than infrastructure and integration tasks. Java Platform, Enterprise Edition (Java EE) is the industry standard for developing portable, robust, scalable and secure server-side Java applications. Building on the solid foundation of the Java Platform, Standard Edition (Java SE), Java EE provides web services, component model, management, and communications APIs that make it the industry standard for implementing enterpriseclass service-oriented architecture (SOA) and next-generation web applications.

2.1.1 J2EE Sever And Prepared Statement When the J2EE server gives your application a connection, it isn't giving you the actual connection; you're getting a wrapper. You can verify this by looking at the name of the class for the connection you are given. It won't be a database JDBC connection, it'll be a class created by your application server. Normally, if you called close on a connection then the jdbc driver closes the connection. We want the connection to be returned to the pool when close is called by a J2EE application. We do this by making a proxy jdbc connection class that looks like a real connection. It has a reference to the actual connection. When we invoke any method on the connection then the proxy forwards the call to the real connection. But, when we call methods such as close instead of calling close on the real connection, it simply returns the connection to the connection pool and then marks the proxy connection as invalid so that if it is used again by the application we'll get an exception.

Wrapping is very useful as it also helps J2EE application server implementers to add support for prepared statements in a sensible way. When an application calls

Connection.prepareStatement, it is returned a PreparedStatement object by the driver. The application then keeps the handle while it has the connection and closes it before it closes the connection when the request finishes. However, after the connection is returned to the pool and later reused by the same, or another application, , then ideally, we want the same PreparedStatement to be returned to the application. 2.1.2.The advantages of J2EE The J2EE framework today provides the standard platform for distributed applications. It creates a standard in which application components can be distributed and reused. The evolution of component frameworks has matured to provide significant benefits for application development:

Code reusability Simplification of the development process Faster maintenance due to smaller units of code Better performance through load-balancing and distribution of components Higher scalability of the application
Technically J2EE is not a language; it is a group of specifications, frameworks, technologies, etc. for building distributed enterprise systems. J2EE is comprised of a number of programming and scripting languages including Java, XML, JSP, HTML, SQL, and others. Some of the advantages of J2EE include cross-platform portability, availability of open-source libraries, a huge serverside deployment base..

EJBs have become today the widely accepted open standard for components. They provide all the benefits described above and add the important concept of portability. There are numerous providers of J2EE servers today, all conforming to open standards, thus enabling to freely choose the environment. the customer

2.2 JAVA SERVER PAGE Java Server technology consists of Java-based frameworks and APIs that together provide a versatile combination, capable of building many kinds of server applications that are portable and scalable. Front-end servers::- The most visible portion of servers are the front-end Java provides server APIs for the following: Message exchanges Java Message Services (JMS) provides message queuing services and can be used for message business-to-business (B2B) communication or communication between

applications (A2A or EAI) JMS provides both point-to-point and publish/subscribe asynchronous message queuing. Back-end servers::- built with Enterprise JavaBeans technology provide distributed business and transaction processing. EJB provides containers for two types of Enterprise JavaBeans, Session Beans and Entity Beans: Session Beans provide control over interaction with users. Session Beans can be "stateless" or "stateful" (such as for shopping carts). Entity Beans represent persistent entities (such as accounts, product inventory) that are stored in databases or in external applications.Entity Beans can be managed by the container in what is called Container Managed Persistence (CMP), or by the bean itself in Bean Managed Persistence (BMP). Both CMP and BMP can use Object Relational Mapping Tools to map beans to database entitites. Communication with EJB containers uses Java Naming and Directory Services (JNDI) plus Remote Method Invocation (RMI), and possibly SOAP or JMS. J2EE-branded servers supply a Deployment Tool that automates the configuration process between the front-end servers and EJB containers and between containers. 2.2.1 Advantages Of JSP

vs. Active Server Pages (ASP). ASP is a similar technology from Microsoft. The advantages of JSP are twofold. First, the dynamic part is written in Java, not Visual Basic or other MS-specific language, so it is more powerful and easier to use. Second, it is portable to other operating systems and non-Microsoft Web servers.

vs. Pure Servlets. JSP doesn't give you anything that you couldn't in principle do with a servlet. But it is more convenient to write (and to modify!) regular HTML than to have a zillion println statements that generate the HTML. Plus, by separating the look from the content you can put different people on different tasks: your Web page design experts can build the HTML, leaving places for your servlet programmers to insertthedynamic content.

vs. Server-Side Includes (SSI). SSI is a widely-supported technology for including externallydefined pieces into a static Web page. JSP is better because it lets you use servlets instead of a separate program to generate that dynamic part. Besides, SSI is really only intended for simple inclusions, not for "real" programs that use form data, make database connections, and the like.

vs. JavaScript. JavaScript can generate HTML dynamically on the client. This is a useful capability, but only handles situations where the dynamic information is based on the client's environment. With the exception of cookies, HTTP and form submission data is not available to JavaScript.

vs. Static HTML. Regular HTML, of course, cannot contain dynamic information. JSP is so easy and convenient that it is quite feasible to augment HTML pages that only benefit marginally by the insertion of small amounts of dynamic data. Previously, the cost of using dynamic data would preclude its use in all but the most valuable instances.

2.3 CLOUDSCAPE DATABASE A Cloudscape database contains dictionary objects such as tables, columns, indexes, and jar files. A Cloudscape database can also store its own configuration information. The Database Directory:- A Cloudscape database is stored in files that live in a directory of the same name as the database. Database directories typically live in system directories. Connecting to Databases:- You connect to a database using a form of the Cloudscape connection URL as an argument to the DriverManager.getConnection call (see Cloudscape JDBC Database Connection URL). You specify a path to the database within this connection URL. 2.3.1 Cloudscape Security Features Because Cloudscape does not support traditional grant and revoke features, the security model has some basic limitations. For both embedded and client/server systems, it assumes that users are trusted. You must trust your full-access users not to perform undesirable actions. You lock out non fullaccess users with database properties, which are stored in the database (and in an encrypted database these properties are also encrypted). Note, however, for a distributed/embedded system that a sophisticated user with the database encryption key might be able to physically change those properties in the database files. In addition, in the Cloudscape system, it is not necessary to have a specific connection (or permission to access a particular database) to shut down the system. Any authenticated user can shut down the system. 2.3.2 Value-Added Features

Zero administration: IBM Cloudscape can be easily deployed by adding the core database
server with your Java application.

Multiple platform compatibility: IBM Cloudscape fully supports Sun Microsystems Java
technology standards and runs on any standard JVM V1.3, or later. It supports Java 2 and J2EE.

Full-featured database in compact design: IBM Cloudscape is fine-tuned for efficient use of
resources and a high number of concurrent users. Other features

Read-committed, read-uncommitted, serializable, and repeatable-read isolation

levels

Row-level locking Optimal transaction performance Low memory overhead for connections Fast access time and space reclamation for long rows Cost-based optimizer that supports hash joins, sort avoidance, and row-level or tablelevel locking based on percent of data selected

 Fast query compilation Multiple user support Built-in performance diagnostics: query statistics, locks, and space usage
Advanced security features

Signed Java Archive (JAR) files LDAP or application-defined secure user authentication

CHAPTER 3 PROTOCOLS 3.1 INTRODUCTION The Java Mail API has been used to implement notification services in J2EE applications. Emails were an easy way to notify end-users of business events in an application. With the emergence of new notification channels (such as WAP Phones, Instant Messaging applications, and SMS Pagers), sending notifications has become more complicated. Now, applications have to support an ever- changing set of communication channels that end users would like to be notified on. Each of these channels has a separate API that must be used to communicate with it, so a considerable amount of time will be needed by developers to code these API's into their applications. Additionally, once developers have finished building the communication mechanisms, they will also need a way of determining where to contact an end user at what time (i.e. should an email be sent to the users PC, or should a SMS page be sent to the users cell phone, or both?). 3.2. SMTP SMTP or Simple Mail Transfer Protocol is a way to transfer email reliably and efficiently. SMTP is a relatively simple, text-based protocol, where one or more recipients of a message are specified (and in most cases verified to exist) and then the message text is transferred. You can think of SMTP as the language that mail servers use to communicate among themselves. Since this protocol started out as purely ASCII text-based, it did not deal well with binary files. When the user wants to send a message to someone, the sender-SMTP establishes a two-way transmission channel to a receiver-SMTP. SMTP commands are generated by the sender-SMTP and sent to the receiver-SMTP. SMTP replies are sent from the receiver-SMTP to the sender-SMTP in response to the commands. In case a direct connection does not exist between the sender and the final destination, the message may be sent via one or more relay SMTP-servers. The relay SMTP-servers first act as receivers and then relays the message to the next SMTP. To be able to provide the relay capability the SMTP-server must be supplied with the name of the ultimate destination host as well as the destination mailbox name. Once the transmission channel is established, the SMTP-sender sends a MAIL command indicating the sender of the mail. If the SMTP-receiver can accept mail it responds with an OK reply. The SMTP-sender then sends a RCPT command identifying a recipient of the mail. If the SMTP-receiver can accept mail for that recipient it responds with an OK reply; if not, it responds with a reply rejecting that recipient (but not the whole mail transaction). The SMTP-sender and SMTP-receiver may negotiate several recipients. When the recipients have been negotiated the SMTP-sender sends the mail data, terminating with a special sequence. If the SMTP-receiver successfully processes the mail data it responds with an OK reply. The dialog is purposely lock-step, one-at-a-time.

SMTP uses TCP port 25. SMTP started becoming widely used in the early 1980s. At the time, it was a complement to UUCP (Unix to Unix CoPy) which was better suited to handle e-mail transfers between machines that were intermittently connected. SMTP, on the other hand, works best when both the sending and receiving machines are connected to the network all the time. Sendmail was one of the first (if not the first) mail transfer agent to implement SMTP. Since this protocol started out as purely ASCII text-based, it did not deal well with binary files. Standards such as Multipurpose Internet Mail Extensions MIME were developed to encode binary files for transfer through SMTP. MTAs developed after sendmail also tended to be implemented 8-bit-clean, so that the alternate "just send eight" strategy could be used to transmit arbitrary data via SMTP.

SMTP Commands/Replies <---------------> and Mail

+------+ <>| File | |System| +

Sender-SMTP

ReceiverSMTP
Fig: 3.1 Model for SMTP Use

3.2.1. SMTP Commands Given below are some basic commands with their brief descriptions. The SMTP standard defines many more commands, most of which are optional to implement. HELLO (HELO) This is the first command that is sent when a connection is established. It is used to identify the sender-SMTP to the receiver-SMTP. The argument field contains the host name of the senderSMTP.
HELO <SP> <domain> <CRLF>

Note: <SP> stands for a space and <CRLF> stands for a combination of Carriage Return and Linefeed. The receiver-SMTP identifies itself to the sender-SMTP in the connection greeting reply and in the response to this command.

MAIL (MAIL) There are three steps to SMTP mail transactions. The transaction is started with a MAIL command which gives the sender identification. A series of one or more RCPT commands follows giving the receiver information. Then a DATA command gives the mail data. And finally, the end of mail data indicator confirms the transaction. The first step in the procedure is the MAIL command. The <reverse-path> contains the source mailbox.
MAIL <SP> FROM:<reverse-path> <CRLF>

If accepted, the receiver-SMTP returns a 250 OK reply. The <reverse-path> can contain more than just a mailbox. The <reverse-path> is a reverse source routing list of hosts and source mailbox. The first host in the <reverse-path> should be the host sending this command.

RECIPIENT (RCPT) This command gives a forward-path identifying one recipient. If accepted, the receiver-SMTP returns a 250 OK reply, and stores the forward-path. If the recipient is unknown the receiver-SMTP returns a 550 Failure reply. This second step of the procedure can be repeated any number of times.
RCPT <SP> TO:<forward-path> <CRLF>

The <forward-path> can contain more than just a mailbox. The <forward-path> is a source routing list of hosts and the destination mailbox. The first host in the <forward-path> should be the host receiving this command. DATA (DATA)

The third step in the procedure is the DATA command.

DATA <CRLF>

If accepted, the receiver-SMTP returns a 354 Intermediate reply and considers all succeeding lines to be the message text. When the end of text is received and stored the SMTP-receiver sends a 250 OK reply. Since the mail data is sent on the transmission channel the end of the mail data must be indicated so that the command and reply dialog can be resumed. SMTP indicates the end of the mail data by sending a line containing only a period. The mail data includes the memo header items such as Date, Subject, To, Cc, From etc. VERIFY (VRFY)

This command asks the receiver to confirm that the argument identifies a user. If it is a user name, the full name of the user (if known) and the fully specified mailbox are returned.
VRFY <SP> <user name> <CRLF>

RESET (RSET)

This command specifies that the current mail transaction is to be aborted. The receiver must send an OK reply.
RSET <CRLF>

NOOP (NOOP)

This command does not affect any parameters or previously entered commands. It specifies no action other than that the receiver send an OK reply.
NOOP <CRLF>

QUIT (QUIT)

This command specifies that the receiver must send an OK reply, and then close the transmission channel.
QUIT <CRLF>

In order to make SMTP workable, the following minimum implementation is required for all receivers: MAIL RCPT DATA RSET

NOOP QUIT

3.3. POP3 Post Office Protocol, a protocol used to retrieve e-mail from a mail server. Most e-mail applications (sometimes called an e-mail client) use the POP protocol, although some can use the newer IMAP (Internet Message Access Protocol). There are two versions of POP. The first, called POP2, became a standard in the mid-80's and requires SMTP to send messages. The newer version, POP3, can be used with or without SMTP. POP3 (Post Office Protocol 3) is the most recent version of a standard protocol for receiving e-mail. POP3 is a client/server protocol in which e-mail is received and held for you by your Internet server. Periodically, you (or your client e-mail receiver) check your mail-box on the server and download any mail, probably using POP3. This standard protocol is built into most popular e-mail products, such as Eudora and Outlook Express. It's also built into the Netscape and Microsoft Internet Explorer browsers. POP3 is designed to delete mail on the server as soon as the user has downloaded it. However, some implementations allow users or an administrator to specify that mail be saved for some period of time. POP can be thought of as a "store-and-forward" service. An alternative protocol is Internet Message Access Protocol (IMAP). IMAP provides the user more capabilities for retaining e-mail on the server and for organizing it in folders on the server. IMAP can be thought of as a remote file server.

POP and IMAP deal with the receiving of e-mail and are not to be confused with the Simple Mail Transfer Protocol (SMTP), a protocol for transferring e-mail across the Internet. You send email with SMTP and a mail handler receives it on your recipient's behalf. Then the mail is read using POP or IMAP. .

Fig 3.2 Working of protocol

CHAPTER 4 SYSTEM STUDY

4.1 INTRODUCTIONAll projects are feasible when given unlimited resources and infinite time. It is both necessary and prudent to evaluate the feasibility of a project at the earliest possible time. A feasible study is not warranted for system in which economic justification is observed, technical risk is low, few legal problems are expected and no reasonable alternative exists. An estimate is made of whether the identified user needs may be satisfied using our recent software and hardware technologies. The study will decide if the proposed system will be cost effective, from the business point of view and it can be developed in the existing budgetary constraints. The feasibility study should be relatively sharp ad quick. The gesture should inform the decision of whether to go ahead with a more detailed analysis.

Feasibility study may be documented as a separated report to higher officials of the toplevel management and can be included as appendices to the system specification. Feasibility and risk analysis is detailed in many worries. If there is more project risk then the feasibility of producing the quality software is reduced. The study is done in two phase 4.1.1 Operational Feasibility

In the proposed System named V3mailserver the operational feasibility study is performed with the help of the users of the system and the management. The first challenge was whether the system meets the organizational requirement. This is checked by the system requirement collected from the users and the management and the operational feasibility proved that the system is capable to meet its functional requirements. During the operational feasibility study the proposed system, is checked whether it can run with universal standards. All the business methods implemented in the system is selected according to increase the user acceptance. There was no difficulty in implemented the software and proposed system is so effective, user friendly, functionally reliable so that the users in the company will find that the new system reduces the hard steps.

4.1.2 Technical Feasibility In the proposed system named V3mailserver the technical feasibility study is conducted by considering the risk related to developing the system, the resources available to develop the system and the availability of the technology to develop the system. The development risk considered the factors like whether the system can implement using existing technology and the design of the system can run on the real environment. The resource availability checks the availability of resources like time, human, hardware etc. The technology using to implement the system is selected according to the technical

feasibility study. The technical feasibility study on the technology found that it can implement all the functional requirements of the proposed system. The technology selected according to accept the system globally and the development of the system according to the universal standards. Technical feasibility study of V3mailserver covered the hardware as well as the software requirements. The scope was whether the work for the project is done with the current equipments and the existing software technology has to be examined in the feasibility study. The outcome was found to be positive.

CHAPTER 5 SYSTEM ANALYSIS Requirement analysis can be defined as a detailed study of various operations performed by a system and their relationship within and outside of the system. One aspect of the analysis is designing the boundaries of the system and determining whether or not a candidate system should other related systems. During analysis data are collected on the available files, decision points and transactions handled by the present system. The common tools used in the analysis phase are Data Flow Diagram, interviews and on site observations. We can say Analysis as the process of taking known facts concerning a system, breaking these into their elements and establishing logical relationships between the laments, with objective of producing a specification of requirements. Analysis can be done in a disciplined way, using appropriate tools in all stages of the project. During fact-finding, the use of standard forms will help to ensure that nothing conflicts or is omitted. The tool of analysis consists of lists, structure charts, grid charts and flow charts. The steps in the analysis are:

Defining system objectives and results. Trace back to the actions required for the achievement of objectives and results. Carry out instructions, which prompt the achievement of objectives and must be analyzed In
relation to the decisions, which produce them.

Confirm the notifications that have been carried out. The information based on the decisions can be analyzed into the data and procedures required to
produce it. At each step it is necessary to:

Identify the relevant facts, and establish the relationship between them. Compare that set of facts with the sets at each adjoining steps and establish the relationship
between the facts in these sets.

CHAPTER 6 SYSTEM DESIGN 6.1 FUNDAMENTAL DESIGN CONCEPTS

A set of fundamental design concepts are evolved over the past decades, although the degree of interest in each concept has varied over the years, each has stood the test of time. Each one provides the software designer with a foundation from which more sophisticated design methods can be applied. Fundamental design concepts provide the necessary frame work for "getting it right".

6.2 MODULARITY

Modularity is the single attribute software that allows a program to be intellectually manageable. Software architecture embodies modularity, that is , software is divided into named and addressable component called modules that are integrated to satisfy problem requirements. We have divided our project into four modules. Administrator, Inbox, My settings and Protocol.

6.3 DATA STRUCTURE

Data structure is a representation of logical relationship among individual elements of data. Because the structure of information will invariably affect the final procedural design, data structure is very important as the program structure to the representation of the software architecture. Data structure dictates the organization, methods of access, degree of associatively, and processing alternatives for information. The organization and complexity of a data structure are limited only by ingenuity of the designer. Scalar item array and Array list and Vectors are some of the representations of the data structure used in our project.

CHAPTER 7 DATABASE DESIGN The overall objective in the development of database technology has been to treat data as an organizational resource and as an integrated whole. DBMS allow data to be protected and organized separately from other resources. Database is an integrated collection of data. The most significant form of data as seen by the programmers is data as stored on the direct access storage devices. This is the difference between logical and physical data. Database files are the key source of information into the system. It is the process of designing database files, which are the key source of information to the system. The files should be properly designed and planned for collection, accumulation, editing and retrieving the required information. The organization of data in database aims to achieve three major objectives:-

Data integration. Data integrity. Data independence.

The proposed system stores the information relevant for processing in the MS SQL SERVER database. This database contains tables, where each table corresponds to one particular type of information. Each piece of information in table is called a field or column. A table also contains records, which is a set of fields. All records in a table have the same set of fields with different information. There are primary key fields that uniquely identify a record in a table. There are also fields that contain primary key from another table called foreign keys.

7.1 NORMALIZATION

Normalization is a technique of separating redundant fields and braking up a large table in to a smaller one. It is also used to avoid insertion, deletion and updating anomalies. All the tables have been normalized up to the third normal form. In short the rules for each of the three normal forms are as below.

First Normal Form A relation is said to be in 1NF if all the underlying domain of attributes contain simple individual values.

Second Normal Form The 2NF is based on the concept of full functional dependency. A relation said to be in 2NF if and only if it is in 1NF and every non-key attribute is fully functionally dependent on candidate key of the table. Third Normal Form

The 3NF is based on the concept of transitive dependency. A relation in 2NF is said to be in 3NF if every non-key attribute is non-transitively. 7.2 TABLES
Table 7.1 REGISTER

FIELD FNAME LNAME GENDER MAHLHD PASSWD SQUES ANS BDAY OCCUPATION EDUCATION ZIP ALTID MOBILE ROLL

DATATYPE VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR

CONSTRAINTS

PRIMARY KEY

The above table stores the details of registered user such as user name, password, etc. The entries in the table all inserted during the new user registration process. OFFPHONE VARCHAR MOB VARCHAR Table 7.2 ADDRESS VARCHAR ADDRESSBOOK BDAY VARCHAR MAILID VARCHAR

FIELDDATATYPECONSTRAINTSFNAMEVARCHARMNAMEVARCHARLNAMEVARC HARNNAMEVARCHARPRIMARY KEYEMAILVARCHARALTIDVARCHARHPHONEVARCHAR

The above table stores the details of friends such as user name, mailid, etc. The entries in the table all inserted during adding friends to addressbook.
Table 7.3 INBOX

FIELD MSGID SENDER SUBJECT DAT MSG SIZ MAILID

DATATYPE LONGINT VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR

CONSTRAINTS PRIMARY KEY

STATUS

INT

The above table stores the details of message such as message id, sender, data etc. The entries in the table all inserted during the retrieving of mails

Table 7.4 MYFOLDER

FIELDDATATYPECONSTRAINTSMSGIDLONGINTPRIMARY KEYSENDERVARCHARSUBJECTVARCHARDATVARCHARMSGVARCHARSIZVA RCHARMAILIDVARCHAR

The above table stores the details of mail such as message id, sender, data, etc. The entries in the table all inserted when user move mail to myfolder
Table 7.5 SENT FOLDER

FIELD MSGID MAILID SENDER SUBJECT DAT MSG STATUS

DATATYPE LONGINT VARCHAR VARCHAR VARCHAR VARCHAR VARCHAR I NT

PRIMARY KEY

The above table stores the details of mail such as message id, sender, data, etc. The entries in the table are inserted when user send mails.

Table 7.6 SIGNATURE

FIELD SIGNID SIGNATURE MAILID

DATATYPE INT VARCHAR VARCHAR

CONSTRAINTS PRIMARY KEY

The above table stores the details of signature of the user. The entries in the table all

Table TRASH

7.7

FIELDDATATYPECONSTRAINTSMSGIDLONGINTPRIMARY KEYSENDERVARCHARSUBJECTVARCHARDATVARCHARMSGVARCHARSIZV ARCHARMAHLHDVARCHAR

inserted when user add signature The above table stores the details of mails deleted from inbox such as message id, sender, data, etc. The entries in the table all inserted when user delete mail.

7.3 DATA FLOW DIAGRAMS Data Flow Diagram is the graphical description of the system's data and how the processes transform the data. Data Flow diagram depicts information flow, the information flow and the transforms that are applied as data move from the input to output. It is the starting point of the design phase that functionally decomposes the requirement specifications down to the lowest level of details. Thus a DFD describes what data flows (logical) rather than how they are processed.

Unlike detailed flowchart, Data Flow Diagrams do no supply detailed description of the modules but graphically describes a system's data and how the data interacts with the system. To construct a Data Flow Diagram, we use

> Arrows > Circles > Open End Box > Squares
An arrow identifies the dataflow in motion. It is a pipeline through which information is flown like the rectangle in the flowchart. A circle stands for process that converts data into information. An open-ended box represents a data store, data at rest or a temporary repository of data. A square defines a source or destination of system data.

Rules for constructing a Data Flow Diagram

> > > > >

Arrows should not cross each other. Squares, circles and files must bear names. Decomposed data flow squares and circles can have same names. Choose meaningful names for data flow Draw all data flows around the outside of the diagram.

CHAPTER 8 CODING The goal of coding phase is to translate the design of the system in to code in a given programming language. For a given design, the aim in this phase is to implement the design in the best possible manner. Well-written code can reduce the resting and maintenance effort. During coding, the focus should on developing programs that are easy to read and understand and not simply on developing programs that are easy to write. Simplicity and clarity should be strived for during the code phase. An important concept that helps the understandability of programs is structured programming. The program that should be organized as a sequence of statements and during execution the statements are executed in the sequence given in the program. There are many different criteria for judging of the program, execution time and required memory.

CHAPTER 9 SYSTEM IMPLEMENTATION Implementation includes all those activities that take place to convert from the old system to the new. The old system consists of manual operations, which is operated in a very different manner from the proposed new system. A proper implementation is essential to provide a reliable system to meet the requirements of the organizations. An improper installation may affect the success of the computerized system.

9.1 IMPLEMENTATION METHODS

There are several methods for handling the implementation and the consequent conversion from the old to the new computerized system. The most secure method for conversion from the old system to the new system is to run the old and new system in parallel. In this approach, a person may operate in the manual older processing system as well as start operating the new computerized system. This method offers high security, because even if there is a flaw in the computerized system, we can depend upon the manual system. However, the cost for maintaining two systems in parallel is very high. This outweighs its benefits. Another commonly method is a direct cut over from the existing manual system to the computerized system. The change may be with in a week or with in a day. There are no parallel activities. However, there is no remedy in case of a problem. This strategy requires careful planning. A working version of the system can also be implemented in one part of the organization and the personnel will be piloting the system and changes can be made as and when required. But this method is less preferable due to the loss of entirety of the system.

9.2 IMPLEMENTATION PLAN The implementation plan includes a description of all the activities that must occur to implement the new system and to put it into operation. It identifies the personnel responsible for the activities and prepares a time chart for implementing the system.

The implementation plan consists of the following steps.

List all files required for implementation.

Identify all data required to build new files during the implementation. List all new documents and procedures that go into the new system.

CHAPTER 10 SYSTEM TESTING Testing is the major quality measure employed during software development. After the coding phase, computer programs are available that can be executed for testing purposes. Testing not only has to uncover errors introduced during coding, but also locates errors committed during the previous phases. Thus the aim of testing is to uncover requirements, design or coding errors in the program.

10.1 TYPES OF TESTING

This is the phase where bug in the program was to be found and corrected. One of the goals during dynamic testing is to produce a test suite. This is applied to ensure that the modification of the program does not have any side effects. This type of testing is called regression testing. Testing generally removes all the residual bugs and improves the reliability of the program. The basic testing types are

> Unit testing > Integration testing > Validation testing > Output testing > User acceptance testing
10.1.1 Unit Testing

This is the first level of testing. In this different modules are tested against the specifications produced during the design of the modules. Unit testing is done for the verification of the code produced during the coding of the single module in an isolated environment. Unit testing first focuses on the modules independently of one another to locate errors. After coding, each dialogue is tested and run individually. All unnecessary coding were removed and it was ensured that all the modules worked, as the programmer would expect. Logical errors found were corrected.

So, by working all the modules independently and verifying the outputs of each module in the presence of staff was conducted that the program was functioning as expected.

10.1.2 Integration Testing

Data can be lost access an interface, one module can have as adverse effect on another sub-functions when combined, may not produce the desired major functions. Integration testing is a systematic testing for constructing the program structure, while at the same time conducting test to uncover errors associated within the interface. The objectives are to take unit tested as a whole. Here

correction is difficult because the vast expenses of the entire program complicate the isolation of causes. Thus in the integration testing step, all the errors uncovered are corrected for the next testing stages.

10.1.3 Validation Testing

This provides the final assurance that the software meets all the functional, behavioral and performance requirements. The software is completely assembled as a package. Validation succeeds when the software functions in a manner in which the user expects. Validation refers to the process of using software in a live environment in order to find errors. During the course of validating the system, failures may occur and sometimes the coding has to be changed according to the environment. Once the application was free all the logical and interface errors, inputting dummy data ensured that the software developed satisfied all the requirements of the user.

10.1.4 Output Testing

After performing the validation testing, the next step is the output testing of the proposed system since no system could be useful if it does not produces the required output generated or considered into two ways; one is on screen and another is printed format. The output format on the screen is found to be correct as the format was designed in the system design phase according to the user needs.

For the hard copy also the output comes out as the specified requirements by the user. Hence output testing does not result in any correction in the system.

10.1.5 User Acceptance Testing

User acceptance of a system is the key factor for the success of any system. The system under consideration is tested for user acceptance by constantly keeping in touch with the prospective system users at the time of developing and making changes whenever required. Preparation of test data plays a vital role in the system testing. After preparing g the test data the system under study is tested using the test data. While testing the system by using the test data, errors are again uncovered and corrected and the corrections are also noted for the future.

CHAPTER 11 SYSTEM SPECIFICATION 11.1 HARDWARE REQUIREMENTS

Client machine: Processor : Monitor : RAM : Hard Disk : Keyboard : Modem : Mouse : NIC :

Intel Pentium I or higher. Min 14" color monitor 64 MB 40 GB Standard 104 keys 56 KBPS Serial mouse. 10/100 Ethernet LAN

Server Machine Processor Monitor RAM Hard Disk Keyboard Modem Mouse NIC : : : : : : : : Intel Pentium IV or higher with minimum 1 GHz Speed. Min 14" color monitor 1 GB 40 GB (Or higher for Code backup) Standard 104 keys 56 KBPS Serial mouse 10/100 Ethernet LAN

11.2 SOFTWARE REQUIREMENTS

Client's Machine Operating system Browser : Windows, Linux : Internet Explorer 5.5 or any http Browser Internet connection with a valid internet service provider Server Machine Operating system Scripting Database Layer Server : Redhat Linux Enterprise Edition : Java Script : Cloudscape : J2ee Server

11.3 TECHNOLOGY SPECIFICATION

Client-Server Architecture Typical client-server systems are based on the 2-tiered architecture, whereby there is a clear separation between the data and the presentation/business logic. These are generally data driven, with the application existing entirely on the client machine while the database server is deployed somewhere in the organization.

2-Tier Architecture In a traditional 2- Tiered application, the processing load is given to the client PC while the server simply acts as a traffic controller between the application and data. As a result, not only does the application performance suffer due to the limited resources of the PC, but the network traffic tends increase as well.

Client

Fig 11.1: 2 Tier Architecture

3 - Tier Architecture In 3- Tier architecture an application is broken into three separate logical layers, each with a well - defined set of interfaces. The first tier is referred to as the presentation layer and typically consists of graphical user interface of some kind. The middle tier, or business layer, consists of application or business layer and the third layer- the data layer contains the data that is needed for the application. The middle tier is basically the code that the user calls upon to retrieve the desired data. The presentation layer then receives the data and formats it for display. This separation of application logic from the user interface adds enormous flexibility to the design of application. The third tier contains the data that is needed for the application. n- Tier Architecture In an n - tier architecture the application logic is divided by function rather than physically. N - Tier architecture then breaks down like this:

> A user interface that handle the user's interaction with the application; this can be web browser
running through a firewall, a heavier desktop application or even a wireless device

> Presentation logic that defines what the user interface displays and how a user's requests are handleddepending on what user interfaces are supported we need to have slightly different versions of the presentation logic to handle the client appropriately.

> Business logic that models the application's business rules, often through the interaction with the
application's data.

> Interface services that provide additional functionality required by the application components, such
as messaging, transactional support etc.

> The Data layer where the enterprise's data resides.

CHAPTER 12 FORMS

Fig: 12.1 L:ogin Form

Using the above form you can login into theV3mailserver

Fig: 12.2 Forgot Password

Using the above form you can get the password if you forget it.

Fig: 12.3 Registration Form

Using the above form you can register to the V3mailserver. Using the above form you can see your mails in the V3mailserver

Fig:12.4

Using the above form you can add and view your contacts from the V3mailserver.

Fig: 12.5 Address Book Form

Using the above form you can compose mail.

Fig: 12.6 Compose Form

Using the above form you can add signature and change your password.

Fig:12.7 Form

Mysettings

CHAPTER 13 CONCLUSION

The project report entitled "V3 MAILSERVER" has come to its final stage. The system has been developed with much care that it is free of errors and at the same time it is efficient and less time consuming. The important thing is that the system is robust. Also provision is provided for future developments in the system. The entire system is secured. This online system will be approved and implemented soon.

RESUME

The developed system is flexible and changes can be made easily. The system is developed with an insight into the necessary modification that may be required in the future. Hence the system can be maintained successfully without much rework. Our future plan is to provide an option to attach files. V3MAILSERVER can also be improved by providing mobile alerts and chatting facility. In our project we also plan to add AJAX. Ajax (also known as AJAX), shorthand for "Asynchronous JavaScript and XML", is a web development technique for creating interactive web applications. The intent is to make web pages feel more responsive by exchanging small amounts of data with the server behind the scenes, so that the entire web page does not have to be reloaded each time the user requests a change. This is meant to increase the web page's interactivity, speed, and usability.

REFERENCES

1. Roger.S.Pressman (2005)'Software Engineering: A Practitioner's Approach', McGraw Hill Professional, Fifth Edition. 2. Herbert Schildt (2002) Java 2: The Complete Reference, Fifth Edition; Tata McGraw Hill. 3 www.magicwinmail.net http://java.sun.com. www.infoworld.com

4. 5.